SecReT6
Protein ID: 114319213
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0049
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]53316..54302 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ0ACN1
KEGG IDaeh:Mlg_0049
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-92, Aligned region: 9..310
Protein Sequence: 328 a.a.     [Download]
>gi|114319213|ref|YP_740896.1| hypothetical protein Mlg_0049 [Alkalilimnicola ehrlichii MLHE-1]
MSPGHLATRARHYDFYQLVELLFQQWGWQPEAGSGSGPQVEGVRFRASASLGFPGTDVVALRPCPREGHI
LEVSFLGLHGAQSPLPGYYLEHLAHASAHGEGAAVDLLNFFHHRLLTLLHFAWRKYRHYVRYQDGARDGF
SAALFALSGLADKDLRAESPINWSKLLAYAGLVAGRSRSPEVVGGILAHCFDLEEVAIVPWQARWVAVPD
DQRSRCGTACMSLNRDLTIGDRVVDINGKFLIRIGRLSRRRMADFLPDGRDFAPLKAVVDFLLREPLAYD
LELELMSDQVRPMRLSARDPERLGWTTFLDPRTDAMRRQRRVRLQIRG
 
Nucleotide Sequence: 987 bp     [Download]
>gi|114319166|ref|NC_008340.1|:53316-54302 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
GTGAGCCCGGGGCATCTCGCCACCCGCGCCCGGCACTACGATTTCTATCAGCTGGTGGAACTGCTCTTCC
AGCAATGGGGCTGGCAGCCGGAAGCGGGGAGCGGAAGCGGTCCCCAGGTGGAAGGGGTGCGCTTCCGGGC
CTCCGCGTCGCTGGGTTTTCCCGGCACCGACGTGGTGGCGCTGCGGCCCTGCCCGCGGGAGGGCCATATC
CTCGAGGTCAGTTTTCTCGGGCTGCACGGCGCCCAGTCCCCGCTCCCTGGTTACTACCTGGAGCACTTGG
CGCACGCCAGTGCTCACGGTGAGGGGGCGGCCGTTGACCTGCTGAATTTCTTCCACCACCGGTTATTGAC
CCTGCTCCATTTCGCCTGGCGCAAGTATCGCCACTACGTGCGTTACCAAGACGGGGCGCGCGACGGCTTC
TCGGCGGCGTTGTTCGCCTTGAGCGGGCTGGCGGACAAGGACCTGCGGGCGGAAAGCCCGATCAACTGGA
GCAAGCTGCTGGCGTACGCCGGCCTGGTGGCGGGGCGGTCACGCTCGCCCGAGGTGGTGGGCGGCATCCT
CGCTCATTGCTTCGACCTGGAGGAGGTGGCGATCGTGCCCTGGCAGGCGCGGTGGGTGGCGGTGCCCGAC
GACCAGCGCAGCCGGTGCGGCACGGCCTGTATGAGCCTGAACCGCGATCTCACCATTGGCGACCGGGTGG
TGGACATCAACGGCAAGTTCCTGATCCGCATTGGCCGGTTGTCCCGTCGCCGGATGGCGGATTTTCTCCC
GGATGGGCGGGATTTCGCTCCGCTAAAGGCCGTGGTCGATTTCCTGTTGCGCGAGCCCCTGGCCTACGAC
CTGGAGTTGGAGCTGATGAGCGACCAGGTCCGGCCGATGCGTCTCTCCGCGCGGGACCCCGAGCGACTGG
GCTGGACGACCTTTCTTGATCCACGAACCGATGCCATGCGCCGCCAGCGGCGCGTGCGCCTGCAGATAAG
GGGGTAA