SecReT6
Protein ID: 114319214
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0050
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]54307..55017 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ0ACN0
KEGG IDaeh:Mlg_0050
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.10E-05, Aligned region: 36..102
Protein Sequence: 236 a.a.     [Download]
>gi|114319214|ref|YP_740897.1| FHA domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
MSLQAPTVTLVVINPEIMDGRAAGAHVFDTRGGCLGSDPALSDWCLPDAGGRVHGVHAALRYEQGRFILD
DESGDTRINGVSRPLGRGQRVLLSEGDVLAVGNYRLRVLFGGAGDACPAADLAALAGEPEAVMTSERPPL
MAERADAGSDPLAALGAPSVATHTVADPLRALDAATTFPQEERPLYGPEVPAGDQHAMMMPSRPRYGQDR
PRCPQAAEAAIEAGLQAARREQEEGV
 
Nucleotide Sequence: 711 bp     [Download]
>gi|114319166|ref|NC_008340.1|:54307-55017 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
GTGTCCCTGCAAGCACCCACGGTGACCTTGGTGGTCATCAATCCCGAGATCATGGACGGCCGGGCCGCTG
GCGCCCACGTCTTCGACACCCGGGGGGGCTGCCTGGGCAGCGACCCCGCCCTCAGTGACTGGTGCCTGCC
GGATGCCGGGGGCCGTGTCCATGGGGTGCACGCTGCCCTGCGCTACGAGCAGGGGCGGTTCATCCTGGAT
GATGAATCCGGTGACACCCGCATCAATGGTGTCAGCCGGCCCCTGGGCCGCGGGCAGCGGGTGCTGCTCT
CGGAGGGGGATGTGCTGGCGGTGGGCAACTACCGGCTTCGGGTGCTGTTCGGGGGCGCCGGCGACGCGTG
CCCCGCGGCCGATCTGGCCGCCCTTGCCGGAGAACCAGAGGCGGTCATGACCAGCGAACGTCCGCCTTTG
ATGGCGGAGCGGGCGGACGCGGGGAGCGACCCCCTGGCGGCCCTGGGGGCCCCTTCGGTCGCCACCCACA
CGGTGGCCGACCCGCTGCGCGCCCTGGATGCCGCCACGACCTTCCCGCAGGAAGAGCGGCCCCTTTACGG
GCCGGAGGTGCCGGCCGGCGATCAACACGCCATGATGATGCCGTCCCGGCCCAGATACGGGCAGGATCGG
CCCCGTTGCCCCCAGGCGGCCGAGGCGGCCATTGAGGCCGGGTTGCAGGCCGCGCGGCGCGAGCAGGAGG
AGGGGGTATGA