SecReT6
Protein ID: 114319215
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0051
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]55014..55586 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ0ACM9
KEGG IDaeh:Mlg_0051
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-37, Aligned region: 30..183
Protein Sequence: 190 a.a.     [Download]
>gi|114319215|ref|YP_740898.1| hypothetical protein Mlg_0051 [Alkalilimnicola ehrlichii MLHE-1]
MTISGCARPGRRGSVRLLALLACLVMAPGLSGCAAPLEAAGKVGRVLWDPSIPVGEPEDRPSTASLSLVA
DGDVNPNLVDEGTPLMFRVLQLRDDSMLMAADYGQMKDDLEEALGTNYLSHDDFTLLPGQFKVFQLKALE
EDARYLGLVAYYAEPDRAQWKKVLRVESRGQDYHVLVHLRRHEAELKDES
 
Nucleotide Sequence: 573 bp     [Download]
>gi|114319166|ref|NC_008340.1|:55014-55586 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGACCATCAGTGGGTGTGCCCGTCCTGGCCGGCGCGGGTCGGTCCGGCTGTTGGCCCTGCTGGCCTGCC
TGGTCATGGCGCCGGGGCTGTCCGGGTGCGCAGCGCCGTTGGAAGCGGCCGGAAAGGTGGGCCGGGTGCT
TTGGGACCCGTCGATCCCGGTGGGCGAGCCGGAGGACCGGCCGTCCACAGCGAGCCTGAGCCTGGTGGCC
GATGGGGACGTGAACCCCAACCTGGTGGACGAGGGGACCCCCCTCATGTTCCGGGTCCTGCAGCTTCGGG
ATGACTCCATGCTAATGGCTGCCGACTATGGCCAGATGAAGGATGATCTGGAGGAGGCCCTGGGCACCAA
TTACCTGTCCCACGATGACTTCACCCTGCTGCCCGGCCAATTCAAGGTCTTCCAGCTGAAGGCACTGGAG
GAGGATGCGCGCTACCTCGGCCTGGTGGCCTATTACGCCGAGCCGGATCGGGCGCAATGGAAGAAGGTGC
TGCGCGTGGAGTCGCGCGGCCAGGACTACCACGTACTGGTGCATCTGCGCCGGCACGAAGCCGAACTCAA
GGACGAGAGCTGA