SecReT6
Protein ID: 114319216
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0052
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]55586..56923 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ0ACM8
KEGG IDaeh:Mlg_0052
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-156, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|114319216|ref|YP_740899.1| hypothetical protein Mlg_0052 [Alkalilimnicola ehrlichii MLHE-1]
MVCRNRVVWREGAFIKPHHFQQQQRSLEGLLDLRLQAVSGYSHGFLQLELNSEFLGFGRIALTRARGIMP
DGTAFDLPGDDLEPPPLAVDEAGMANQRVYLGLPLAGDGVAEVSDEDAIRDDGRYRLHRREIWDLHTSPG
DVAELAVARAAPRLLLEHDDRSGYACLAVARILERRPDGSLVLDPDFIPTTLTTRVAPGLQRFIGEVAGL
MQARARRIAQRLAAPQQAGVADVSDFMLLQLLNRLQPRFQHLQQHRRLHPEALYSHMLEACSELATFTDE
SRLPRRYPPYDHDAPDTAFRALMQGLRQALSTVLEARAVAIPLEARRHGLMLAPLSDSTLLDEAEFVVAV
RADMAVETLRRQFIQQTKIAGIERIRDLVSLQLPGIPLVPLPVAPRQLPYHASHIYFQLDRRSEAWGLLT
GASGFAFHLGGDFPGLDLQFWAIRS
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|114319166|ref|NC_008340.1|:55586-56923 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGGTCTGCCGTAACCGAGTCGTTTGGCGTGAAGGGGCGTTCATCAAACCGCACCACTTCCAGCAACAAC
AGCGCAGCCTCGAGGGGCTGCTGGACCTGCGGCTGCAGGCGGTCAGCGGCTACAGCCACGGCTTCCTGCA
ACTGGAACTGAACAGCGAATTCCTGGGCTTCGGCCGGATTGCGCTCACCCGGGCCCGCGGCATCATGCCG
GACGGCACCGCCTTCGACCTGCCGGGCGATGACCTGGAGCCACCACCACTGGCCGTGGACGAGGCCGGCA
TGGCCAACCAGCGGGTCTACCTGGGGCTGCCCCTGGCCGGTGATGGCGTGGCCGAGGTCAGCGACGAGGA
CGCCATCAGGGATGATGGCCGCTACCGCCTGCATCGCCGGGAGATCTGGGATCTTCACACCAGTCCTGGA
GATGTCGCTGAACTGGCGGTGGCCCGCGCCGCCCCGCGCCTGCTGTTGGAGCACGATGACCGCAGCGGTT
ATGCCTGCCTGGCAGTGGCGCGGATACTGGAGCGGCGCCCGGATGGTTCACTGGTACTCGATCCCGACTT
TATCCCCACCACCCTGACCACCCGGGTGGCGCCCGGCCTGCAGCGGTTCATTGGTGAGGTGGCCGGGTTG
ATGCAGGCGCGAGCGCGTCGGATCGCACAGCGGCTGGCCGCTCCGCAGCAGGCCGGGGTGGCTGATGTCT
CCGACTTCATGCTGCTGCAATTGCTGAACCGCCTGCAGCCCCGGTTCCAGCACCTGCAACAGCACCGGCG
GCTGCACCCGGAGGCCCTCTACAGCCACATGCTGGAGGCCTGCAGCGAACTGGCGACCTTCACCGACGAG
TCGCGGTTGCCCCGGCGCTATCCTCCCTACGACCACGATGCCCCCGATACCGCCTTCCGTGCGCTCATGC
AGGGGCTCCGTCAGGCTCTCTCCACCGTGCTGGAGGCCCGAGCGGTGGCCATTCCCCTGGAGGCCCGCCG
TCACGGGCTCATGCTCGCGCCGCTAAGCGATTCGACGCTGCTGGACGAGGCCGAGTTCGTGGTCGCCGTG
CGCGCGGACATGGCGGTGGAGACGCTGCGCCGACAGTTCATCCAGCAGACGAAGATCGCCGGTATCGAAC
GCATCCGCGACCTGGTCAGTCTGCAACTGCCCGGCATTCCGCTCGTTCCGCTGCCGGTCGCGCCGCGCCA
GCTCCCCTATCACGCGAGTCATATCTACTTCCAGCTCGACCGTCGCAGCGAGGCCTGGGGCCTGCTGACC
GGTGCGAGCGGTTTCGCCTTCCACCTGGGTGGTGACTTCCCAGGGCTGGATCTCCAGTTCTGGGCAATAA
GGAGTTGA