SecReT6
Protein ID: 114319217
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0053
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]56926..57741 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ0ACM7
KEGG IDaeh:Mlg_0053
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-66, Aligned region: 44..249
Protein Sequence: 271 a.a.     [Download]
>gi|114319217|ref|YP_740900.1| hypothetical protein Mlg_0053 [Alkalilimnicola ehrlichii MLHE-1]
MSMTAPIAGPETVPAEAPEPAGGRGTLVPEEPHTAFRLRGHSPNPLVDAASPLLGLVIRVRELEVLDDVA
ALYRQVVEDIGAIELELTEQGLDRPTLLAYRYVLCTFVDEAVMGTEWGQQSDWSRHSLLARFHNETWGGE
KVFAILARLQQEPQRYEPLLTFIYICFSLGFQGRYRIRPDRREEYERIVRSLGEQLSSLQPSGDENLTEP
ERHIAPAGWRSGEGVPAWLIPALSVLVAVGLYLAISWSLDQQAAEVHAFLHQVFADMGDAS
 
Nucleotide Sequence: 816 bp     [Download]
>gi|114319166|ref|NC_008340.1|:56926-57741 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGTCGATGACAGCGCCCATTGCGGGCCCGGAGACCGTGCCAGCGGAGGCACCCGAACCCGCGGGCGGTC
GGGGTACGCTCGTACCCGAGGAGCCGCACACCGCCTTCCGCCTGCGTGGCCACAGCCCGAATCCGCTGGT
GGACGCGGCCAGCCCGCTGCTGGGCCTGGTCATCCGAGTCCGCGAGCTGGAGGTGCTGGACGATGTGGCC
GCGCTCTACCGGCAAGTGGTGGAGGACATCGGTGCCATCGAGCTCGAGCTCACCGAGCAGGGTCTCGACC
GCCCCACGCTGCTGGCCTATCGCTACGTCTTGTGCACCTTCGTCGACGAGGCGGTGATGGGGACCGAGTG
GGGCCAGCAGAGCGATTGGTCCCGGCACTCGTTGCTGGCCCGGTTTCACAACGAGACCTGGGGCGGCGAG
AAGGTCTTCGCCATCCTGGCCCGGCTGCAACAGGAGCCCCAGCGCTACGAGCCACTGCTCACCTTCATCT
ACATCTGCTTCAGCCTGGGTTTCCAGGGGCGCTACCGCATCCGCCCCGACCGACGCGAGGAGTACGAGCG
GATCGTCCGTTCATTGGGGGAGCAACTCTCTAGCCTGCAGCCGTCCGGCGACGAGAACCTGACCGAACCC
GAGCGCCATATCGCGCCCGCCGGCTGGCGATCCGGCGAGGGGGTGCCGGCCTGGTTGATCCCGGCCTTGT
CCGTCCTGGTCGCAGTCGGCCTGTACCTGGCCATATCCTGGTCCTTGGACCAACAGGCCGCCGAGGTCCA
CGCCTTCCTGCACCAGGTCTTCGCGGACATGGGTGACGCATCGTGA