SecReT6
Protein ID: 114319220
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0056
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]59947..61389 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ0ACM4
KEGG IDaeh:Mlg_0056
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-15, Aligned region: 58..118
ImpA-rel_N [PF06812], Evalue: 4.50E-15, Aligned region: 370..383
EH_Signature [PF15611], Evalue: 0.00038, Aligned region: 226..264
EH_Signature [PF15611], Evalue: 0.00038, Aligned region: 339..443
Protein Sequence: 480 a.a.     [Download]
>gi|114319220|ref|YP_740903.1| ImpA domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
MPMVALPHRINREPDLALVLAPLSADRVAGQPVAEDPDYAWLDEELIKVGSLQHGGIDWAGAERRAIRLL
SGLGKDLRVLAHLLHCLQREGDATRFELALLLLQRCLGTWWSEAHPAPGDRGSRWRTRLFSTIVRRAAAL
AEGLEGAAAPTLRRCRHAVDGLRSATQDAGLSPHPLAELDQALVRVTPAPRTAPPADDPGQGEQAPRHQP
PAPEKPSAGARIPELRPGNERANREALQRVADHLNDQSPDHPLGYRLRRYALWRSIDTLPPARDGQRTEL
APMAADLAARYREAVQGRGDHALWARLEQSLAVSPFWLEGHRLSAEMARQLGHEPCARAIREETAHFIAC
LPGLVDLRFSDGSPFADEATRCWLAEEAAAGIAQNGAGEPWDRALAEARESLAEDGLAAALERLDRGLAA
AGSPRASAYWRLASADLLHHAGLQALAHQQYQAVHSVVRGLALERWEPHLVKRLEAIGPR
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|114319166|ref|NC_008340.1|:59947-61389 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGCCAATGGTAGCGCTGCCCCACCGGATCAACCGAGAGCCGGACCTGGCCCTGGTGCTGGCGCCCCTGT
CAGCGGACCGGGTCGCCGGTCAGCCGGTGGCGGAGGACCCGGATTACGCCTGGCTGGACGAGGAGCTGAT
AAAGGTCGGCTCCCTGCAGCACGGCGGGATCGACTGGGCGGGCGCCGAGCGCCGGGCGATCCGGTTGCTG
AGCGGGCTTGGCAAGGACCTCCGGGTGCTTGCGCACCTGCTCCATTGCCTGCAGCGGGAGGGCGACGCCA
CGCGTTTCGAACTGGCGCTGCTGCTGTTGCAGCGTTGTCTTGGCACCTGGTGGTCCGAGGCCCACCCGGC
GCCCGGGGACCGGGGGAGTCGTTGGCGTACCCGCCTGTTCAGCACCATCGTCCGGCGGGCGGCCGCCCTG
GCGGAGGGACTGGAGGGCGCTGCCGCGCCGACCCTCCGTCGGTGTCGGCATGCTGTCGATGGGCTGCGAT
CGGCAACGCAGGATGCCGGCCTGTCTCCGCACCCCCTGGCTGAACTGGACCAGGCGCTGGTCCGCGTCAC
TCCGGCGCCTCGCACAGCCCCGCCGGCGGACGACCCGGGACAAGGCGAGCAGGCGCCCCGGCATCAGCCG
CCCGCCCCGGAAAAGCCGTCGGCCGGCGCGCGCATTCCGGAACTGCGGCCGGGCAACGAGCGAGCCAACC
GCGAGGCCCTGCAGCGCGTGGCCGATCACCTGAACGACCAGAGCCCGGACCACCCGCTGGGTTACCGGTT
GCGCCGCTATGCGCTCTGGCGGTCCATCGACACGCTGCCCCCGGCCCGGGATGGTCAGCGCACCGAGCTG
GCGCCTATGGCCGCGGACCTCGCGGCCCGCTACCGCGAGGCCGTTCAGGGCCGTGGGGATCACGCCCTTT
GGGCCCGCCTGGAACAGAGTCTGGCGGTCAGTCCCTTCTGGCTGGAGGGCCATCGCCTGAGCGCCGAGAT
GGCGCGGCAGCTGGGCCATGAGCCCTGCGCCAGGGCCATCCGGGAGGAGACGGCCCATTTCATCGCCTGC
CTTCCCGGTCTGGTGGACCTCCGGTTCAGTGACGGCAGCCCCTTCGCTGACGAGGCCACCCGGTGCTGGC
TGGCAGAAGAGGCCGCCGCCGGGATTGCACAGAACGGGGCCGGTGAACCCTGGGACCGGGCCCTGGCCGA
AGCCCGGGAAAGCCTGGCGGAGGACGGACTGGCCGCGGCATTGGAACGGCTGGATCGCGGCCTCGCGGCG
GCCGGGTCCCCGAGGGCATCCGCCTACTGGCGCCTGGCCAGTGCCGATCTGTTGCACCACGCGGGCCTAC
AGGCCCTGGCGCACCAGCAGTACCAGGCCGTGCACAGTGTCGTACGGGGGCTGGCACTGGAGCGGTGGGA
ACCGCACCTGGTCAAGCGCCTGGAGGCCATCGGTCCCCGGTGA