SecReT6
Protein ID: 114319222
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0058
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]65285..65803 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ0ACM2
KEGG IDaeh:Mlg_0058
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|114319222|ref|YP_740905.1| hypothetical protein Mlg_0058 [Alkalilimnicola ehrlichii MLHE-1]
MPTPCYVSIQGQTQGNITAGAFTPDSVGNIYVEGHEDEMLVQEVKHVVTVPTDPQSGQPSGQRAHKPLIL
TVALNKSVPLLYNALAAGEMLPEVVLRWYRTSTDGKQEHFFTTTLTDATIVDIDLTMPHAQDTAKAEFTQ
LMDVSLAYRKIDWEHTVAGTSGADDWRSPVES
 
Nucleotide Sequence: 519 bp     [Download]
>gi|114319166|ref|NC_008340.1|:65285-65803 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGCCAACACCTTGCTATGTCAGCATCCAGGGCCAGACCCAGGGCAACATCACTGCCGGTGCCTTCACCC
CCGACTCCGTGGGCAATATCTACGTCGAGGGCCATGAGGACGAGATGCTCGTTCAGGAGGTCAAGCACGT
GGTCACCGTGCCCACGGACCCCCAGTCGGGTCAGCCCTCGGGCCAGCGGGCGCACAAACCGCTGATCCTC
ACGGTGGCGCTCAATAAGTCGGTGCCGCTGCTCTACAATGCCCTGGCCGCCGGCGAGATGCTGCCCGAGG
TGGTACTGCGCTGGTATCGCACCTCCACCGACGGCAAGCAGGAGCATTTCTTCACCACCACCCTCACCGA
TGCCACCATCGTGGACATCGACCTCACCATGCCCCACGCCCAGGACACCGCCAAGGCCGAGTTCACCCAG
CTCATGGACGTCAGCCTGGCCTACCGCAAGATCGACTGGGAGCACACCGTCGCCGGCACCTCCGGTGCCG
ACGACTGGCGCTCTCCGGTGGAGTCCTGA