SecReT6
Protein ID: 114319223
SecReT6 ID145
T6SS typei1
Gene symbol-
Locus tagMlg_0059
StrainAlkalilimnicola ehrlichii MLHE-1
Repliconchromosome [GenBank: NC_008340] [Browse all T6SS(s) in this replicon]
Location [Strand]65890..66189 [+]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDQ0ACM1
KEGG IDaeh:Mlg_0059
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.70E-15, Aligned region: 20..89
DUF4150 [PF13665], Evalue: 0.004, Aligned region: 21..44
DUF4150 [PF13665], Evalue: 0.004, Aligned region: 61..77
Protein Sequence: 99 a.a.     [Download]
>gi|114319223|ref|YP_740906.1| PAAR repeat-containing protein [Alkalilimnicola ehrlichii MLHE-1]
MSRQVMLVGDKDTGHGSCPPTAITSGSPTVQINGRAVARQGDPLAPHRKPKGSTHGRHIASGEPTCLVDG
RPIALTGHPVNCGGSLVAGAGQGVTVGSV
 
Nucleotide Sequence: 300 bp     [Download]
>gi|114319166|ref|NC_008340.1|:65890-66189 Alkalilimnicola ehrlichii MLHE-1 chromosome, complete genome
ATGAGCCGCCAAGTCATGCTGGTCGGCGACAAGGACACCGGCCACGGCAGTTGCCCACCGACCGCGATCA
CCTCCGGCAGCCCCACCGTGCAGATCAATGGCCGAGCGGTCGCACGCCAGGGCGACCCGCTGGCCCCCCA
CCGCAAACCCAAAGGCTCGACCCACGGGCGCCACATCGCCAGTGGCGAGCCCACCTGCCTGGTGGACGGC
AGACCCATCGCCCTGACCGGCCACCCCGTCAACTGCGGCGGAAGCCTGGTGGCCGGGGCTGGGCAGGGGG
TGACCGTGGGTTCCGTGTGA