SecReT6
Protein ID: 115350431
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0377
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]421936..422718 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ0BIT7
KEGG IDbam:Bamb_0377
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.10E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|115350431|ref|YP_772270.1| hypothetical protein Bamb_0377 [Burkholderia ambifaria AMMD]
MSYAPSLFGDNTPAPLQTPASTDAAFQARSLVDLLYDGFFMLFLLKNGREPDSASEFSTKIQEFLSDFER
GAKKLNIAAEDVYAAKFAYCAAVDEMVLSSQFKIRTDWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGRYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDQIAHRLKREVPVW
AIGAVFALVALLGFLGLNTYLKDKTLQALAPYSQVVKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|115350056|ref|NC_008390.1|:c422718-421936 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAGCTACGCGCCCTCCCTGTTCGGCGACAACACGCCGGCACCGCTGCAGACCCCGGCGTCGACCGACG
CCGCGTTCCAGGCCCGTTCGCTGGTCGACCTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTCAAGAA
CGGCCGCGAGCCGGACAGCGCGAGCGAGTTCAGCACGAAGATCCAGGAATTCCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTGAATATCGCCGCGGAAGACGTGTACGCCGCGAAGTTCGCGTATTGCGCGGCGGTCG
ATGAAATGGTGCTGTCGTCGCAGTTCAAGATCCGGACCGACTGGGAGCGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTCGCGGGGGAGAAGTTCTTTCAGTATCTCGAGGAATGTCGCGCGCAGGGCGCGGCG
CGGTTGCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGCTTCCAGGGCAGGTATCTGCTCGAGG
GGCCGGAGAAGCTGGCTTATCTCACCGCGCGGCTAGGCGACGAGATCGCGCATATGAAAGGCAAGCGCGC
GCCGTTCGCGCCGCATTGGCCGCTGCCCGATCAGATCGCGCATCGGTTGAAGCGTGAGGTGCCGGTGTGG
GCGATCGGGGCGGTGTTCGCGCTCGTGGCGCTGCTGGGGTTTCTCGGGCTCAATACGTATCTCAAGGACA
AGACGCTGCAGGCGTTGGCGCCTTACTCGCAAGTCGTCAAGGTCGGACCGGAGTCTGCGAATTTGACGAT
TTCGTTGCCTTGA