SecReT6
Protein ID: 115350432
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0378
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]422715..424061 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ0BIT6
KEGG IDbam:Bamb_0378
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-134, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|115350432|ref|YP_772271.1| hypothetical protein Bamb_0378 [Burkholderia ambifaria AMMD]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPNVELIDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFSLDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|115350056|ref|NC_008390.1|:c424061-422715 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGGCAGG
ACGCCTACCACGAGGCGCGCCTGTTCGAATCCATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGCATCGATCGCGATGCGCTCGGCAGCAACGTGCTGCGCGTGGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCCGACGACTTGCCGCCGCCGATCGCGCTCGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTACCTCGCGCTGCATCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGCTTCGTCAGCGAGCAGACGAGCGTCGCCGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTGCGCGTGCGCCGCACCGCGACGTCCGGGTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCTTCGCCGATCCTCCACCAGCGCTTGCGCCAACTGGTCGACGCG
CTGCAGGCGAAGGTCAACGCGCTGTACGGTTTTCACCGCGAGCCGTCGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCATACCGCGAACGCCGCGTTCGCGACGCTCGCGCACTTGCA
CCAGCATGCGGCGCTGCATCCGGAACGACTGTTCCAGGAACTGCTGCGCCTCGCGGGGCAACTGATGACG
TTCTCGAAGGGCTATACGCTCGCCGATCTGCCCGTGTATCGCCATGACGATCCCGGCCCGAGCTTCGCGC
GTCTCGACCTGATGCTGCGCGAGCTGCTCGACACCGTGATTTCGACGCGCTACTTCGCGATCACGCTCGA
CGAGGTGCGTCCGTCGTTCCACCTCGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTGGCCGTGTCCGCGGACATGCCGAACGTCGAGCTCATCGATGCCGTGCCGGCCCGCTTCAAGGTCGGTG
CGCCCGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATCCCCGTGCGGCCGGGCGCGTGCTATTTCTCGCTCGATTCGCGCGGCGCGTTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACCTCATGA