SecReT6
Protein ID: 115350433
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0379
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]424166..424774 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ0BIT5
KEGG IDbam:Bamb_0379
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-36, Aligned region: 14..174
Protein Sequence: 202 a.a.     [Download]
>gi|115350433|ref|YP_772272.1| hypothetical protein Bamb_0379 [Burkholderia ambifaria AMMD]
MRSMIRYALPLIACALLAGCAAAPLLGSAASAVLQAAGVGKPDLPDAQKPPRNIGLTLAAAPNLNAANDR
KPLALVVRLYALKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYIATEKVSREAQAFGIV
ALFRDPAIQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGSVIAPQQGAPSQPLNLLSSVSCG
 
Nucleotide Sequence: 609 bp     [Download]
>gi|115350056|ref|NC_008390.1|:c424774-424166 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAGATCAATGATTCGCTATGCGCTGCCGCTCATTGCCTGCGCGCTCCTGGCCGGATGCGCGGCCGCCC
CGTTGCTCGGCTCCGCCGCGAGCGCCGTGCTGCAGGCTGCCGGCGTCGGCAAGCCCGATCTGCCGGATGC
CCAGAAGCCCCCGCGCAACATCGGGCTCACGCTCGCCGCCGCGCCCAACCTGAATGCCGCGAACGATCGC
AAGCCGCTCGCATTAGTGGTAAGACTCTACGCGCTGAAGGATCCGACTTCGTTCCAGCAGGCGCCGTTCG
ACGCGTTCACCGATCCGACCAAGGAAAAGGCCGCGCTGGGCGCCGATCTGCTGAACGTGCGTGAAATCAC
GCTGATTCCGGGCCAGCGCTATATCGCGACCGAAAAGGTATCGCGCGAAGCGCAGGCATTCGGCATCGTC
GCGCTGTTCCGCGATCCCGCCATCCAGCGATGGAAACTGACGTTCGACCCGGCGAAGTCGGAGAAATCCG
GCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGATGGCTCCGTGATCGCCCCGCAACAAGG
GGCGCCTTCGCAACCGCTGAATTTGCTTTCGTCGGTCAGCTGCGGTTAA