SecReT6
Protein ID: 115350435
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0381
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]425833..426348 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ0BIT3
KEGG IDbam:Bamb_0381
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.10E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|115350435|ref|YP_772274.1| hypothetical protein Bamb_0381 [Burkholderia ambifaria AMMD]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLDARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|115350056|ref|NC_008390.1|:425833-426348 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATTCGGCCGCCGCGCGTCCAATTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAACTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGCCAGTCGGAAATCGAGCAGCCGAAGCTGCGCGACCGCAAGTTCGTCAATATCGACCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCGCGTTTCAGGTGGAAAACCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGTTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGACGCGCGTTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCGGAAGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CGGGCGGCGACAAAGACGGCGAATGA