SecReT6
Protein ID: 115350436
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0382
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]426364..427854 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ0BIT2
KEGG IDbam:Bamb_0382
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|115350436|ref|YP_772275.1| hypothetical protein Bamb_0382 [Burkholderia ambifaria AMMD]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTEHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|115350056|ref|NC_008390.1|:426364-427854 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGTTGCTCGACG
ATATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGATCGTGTCGGACAACCTGTCGGCGACGATCGACGCGCGC
GTCGCGGAGCTCGACCGCCTGATCTCCACGCAGCTCTCCGCGGTGATGCACGCGCCGGAATTCCAGCGCC
TGGAAAGCACGTGGCGCGGGATGGACTACCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCCCCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGCGCGCTGATCGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCCGCCGC
GCATGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAACTTCAACTTCGTCGAGGATGTGGACGGCACCGAGCACGACAAGTACCTGTGGTGCAAC
GCGGCGTGGGCATTCGCGGCACGCCTGACCGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGTGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTTCATTGCAAGAACTCGGATTACGCTGCGTTCTTCGCCGCGCAATCGGTGCAGAAACCGAAAA
AATACAGCACCGACAGCGCGAATGCGAATGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGACAACGCATCGCAGGAACAGAAGG
CGCAATTCCCGCTGCGCGAGGCATCCATACAAGTGTCAGAGATTCCGGGGAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA