SecReT6
Protein ID: 115350438
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0384
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]428491..428976 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ0BIT0
KEGG IDbam:Bamb_0384
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.50E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|115350438|ref|YP_772277.1| hypothetical protein Bamb_0384 [Burkholderia ambifaria AMMD]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNSRIAHTELELAELPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRTRAARML
 
Nucleotide Sequence: 486 bp     [Download]
>gi|115350056|ref|NC_008390.1|:428491-428976 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCACCTGCCGGCCTCGGCAG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTCGCCCGCGACGTCGAGGCGATCCTCAACAG
CCGTATCGCGCACACCGAACTCGAACTGGCGGAGCTGCCGGAATGCCAGAAGTCGGTGCTGACCTACGGG
CTGAACGATTTCGCGGGGCTGAGCCTCGCGAGTCATTACGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCCATTGCGCGCCACGAGCCGCGGTTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTTTACTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCGGCCGAAGAGCCGGTGAGTTTCGAC
GCGATGTTGCAGCCGTCGACGCTGCAGTATTCGGTCACGCGCACACGCGCGGCAAGAATGCTGTGA