SecReT6
Protein ID: 115350439
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0385
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]429054..430889 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ0BIS9
KEGG IDbam:Bamb_0385
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-215, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|115350439|ref|YP_772278.1| hypothetical protein Bamb_0385 [Burkholderia ambifaria AMMD]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYMPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLPTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAHAGFDEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDVAAIARASGRC
QRATLHLVLQDVRSDSHVARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLAGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|115350056|ref|NC_008390.1|:429054-430889 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCCGCGCGGCTCGCGTTGTCCGGCGAGCACTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTGGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCGGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAAT
TCACGCCGGCTTCGCCCGGCCAGCAGACCGAACCGGTCGTGATCGACCGCGGCACCGAGCTGAAGAGCCG
TCCGATCCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGCATTTCG
GAAGCGCGCTACATGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCCAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTCGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGCCTACGCTGCGCGC
GCACCTGCACGGCGAACAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTCGGCGCG
TATGTCGAGCCCGAGCGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCACGCCGGCTTCG
ACGAGGACGACGCGCTGATCGACTACCCGGCGAAGTCGCACCCCGCCTATCGCCTGCTCACCGAATACTT
CGCGTTCCCCGACAAGTTCGATTTCGTCGATTTCGACGTCGCGGCGATCGCGCGCGCGTCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCACGTCGCGCGGCTGCTCGAGC
TGCTGACGGCCAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAATCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCGGTGTCGTATCCGGTGATCGCCGAAGCGCGCCGGGCGTTCGCGTACGAG
GTGTACTCGATCGATTCGGTGAAGCTCGTTCGGCAGCAGGCGCATGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAATCGGCGCGGATCGGTCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAAAGCCCCGGATACGAAACGGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGATCTGCCGTCGATGCTCGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGTGCGCAGACGAGCGGCATCTCGCTGCTGCGGCGCCC
GACCCAGAGCGTGCGTTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCACCTCGCGCTGAAT
CACGTGTCGCTGGTCGCGCACGGGCTCGCGCCGCTCAAGGAAATGCTGACGCTGTACGATCTGCGGCGCA
CCGCCGTGTCGATGCGCCAGATCGACGGCCTCGCCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAGGAGCACTTCGTC
GGCGCGAGCCTCGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTATGTCCACCTCAACAGTT
TCGTTCAACTAGTCGTGGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG