SecReT6
Protein ID: 115350440
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0386
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]430853..431953 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ0BIS8
KEGG IDbam:Bamb_0386
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|115350440|ref|YP_772279.1| hypothetical protein Bamb_0386 [Burkholderia ambifaria AMMD]
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQHIEFRNTLSLGFPPS
EIEGARSFHDGGALLDSDEERGAALAAGELGHVELTPAFFGLLGAQGALPLHYTEQIVAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEIRDNLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRALSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAHAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
ALDDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|115350056|ref|NC_008390.1|:430853-431953 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCAAGCCCCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AATTCTTCCAGGCGGTGCGCGTGCTCGAAGGGCTGTTCGCGCGGCAGGCGTCCGATGCGCCCGGCGCATG
GCGGCAGGGCGACGTCGTCGCGCAGCACATCGAATTCCGCAACACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAAGGCGCCCGGTCGTTCCACGACGGCGGCGCGCTGCTCGATTCGGATGAGGAACGCGGCGCCG
CGCTCGCGGCCGGCGAGCTCGGTCACGTCGAGCTGACGCCGGCGTTCTTCGGGCTGCTCGGCGCTCAGGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCATTTGAAGCGCGACCACGCGGCACGC
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTACGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCATTACGAACTCGATCGCGACGAGCGCTACCTGCCGCTCTTGCTCGCGATCGCCGGCGTGCCGAG
CGACGAGATCCGCGACAACCTCGCGGCCGGCGCGGGCGGCGTGCTCGACGAGGCCGTCGCCGGCTACGCG
CTCGCCGCGCGGCACCGGCCGATGTCGGCCGCGTACCTGCAGCGCGCGCTGTCCGACTACTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAATGGTACGACGTGCCGCCCGACCAGTTGAGCGTGCTCGGCGA
GGTCAACGCGGTGCTCGGCGCGACGGCGCTCGTCGGCGAACGTGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTGTCCAAGCGCGACTACGAAGCATTCCTGCCCGGCGGCGCGCACGCCGTCGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAGGTGAAGCTCGTGCTGAAGCGCAC
CGAGGTGGGCGCGAGCGTGCTCGGCGCAGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCGCTCGACGACCGCTCGGACGCCCGCTACGAACTGCACGTGATTCACTGA