SecReT6
Protein ID: 115350442
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0388
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]434706..435827 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ0BIS6
KEGG IDbam:Bamb_0388
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|115350442|ref|YP_772281.1| ImpA domain-containing protein [Burkholderia ambifaria AMMD]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDYWDTVHPLPEGDDVEYRLGNVAWLSGRTAELLRG
IPVTEGASNAFTTLDWEVAQHVAQAVKRDPEHADDIARGKPSVEQVDASRRVTPIAFYTTLLANLKAFEF
SLDAFEERLVERAGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHAPSAPQAQPERLEPSFGDAFP
IQETHVQSQTAPRPPMTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|115350056|ref|NC_008390.1|:434706-435827 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCCGATCAATCTTCCCGAGTTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGACGCGCGGCGCTACGATGATCCGACGCTCGACCAGGGCGAGTG
GGTGACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGATCACGCGGGCGAGTTGCTGCGCACGCGC
ACCAAGGACCTGCGGCTCGCCGTGTGGCTGACCGAGGCGCTCGCGCTGGAGGACGGCATCACCGGCCTCA
CCGAAGGCTATGCGCTGCTGGAAGGCCTGTGCCGCGACTATTGGGACACCGTACATCCGCTGCCGGAAGG
CGACGACGTCGAATACCGGCTCGGCAACGTCGCGTGGCTGTCCGGCCGCACGGCCGAGTTGCTGCGCGGC
ATCCCCGTGACGGAAGGCGCGTCGAACGCGTTCACCACGCTCGACTGGGAAGTCGCGCAGCATGTGGCGC
AGGCCGTGAAGCGCGACCCCGAACACGCGGACGACATCGCACGCGGCAAACCGTCGGTCGAGCAGGTCGA
TGCGTCGCGGCGCGTGACGCCGATCGCGTTCTACACGACGCTGCTCGCGAATCTGAAGGCGTTCGAGTTC
TCGCTCGATGCGTTCGAGGAGCGGCTCGTCGAACGTGCGGGCGATTCGGCGCCGAGCTTCCGGCAGGCGC
GAGACGCGTTCGAGACCGTGTACCGGCTCGCCGAGCGCTTTGCGCGCGAGCAGGGCTATACGGGCAGCGC
GCCGCATGCGCCGTCGGCACCGCAGGCGCAGCCCGAGCGCCTCGAGCCGAGCTTCGGCGACGCGTTCCCC
ATCCAGGAGACCCATGTGCAGTCGCAGACCGCTCCGCGTCCTCCGATGACGCAAATGATCGCCGGCATCC
AGAACCGCGCGCAGGCCGTCGACCAGCTGCGCGCCGTCGCGCGTTACTTCCGGCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCGGACAAGGCCGCCGAATGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGGTCGCTGTCGCATATCCGCGAGCTGCTGGGTGTGAGGCCTGATGAGCAGTCGT
GA