SecReT6
Protein ID: 115350445
SecReT6 ID148
T6SS typei4b
Gene symbol-
Locus tagBamb_0391
StrainBurkholderia ambifaria AMMD
Repliconchromosome I [GenBank: NC_008390] [Browse all T6SS(s) in this replicon]
Location [Strand]437736..438686 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDQ0BIS3, Q0BIS3
KEGG IDbam:Bamb_0391
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.10E-26, Aligned region: 150..182
OmpA [PF00691], Evalue: 2.10E-26, Aligned region: 214..308
BON [PF04972], Evalue: 0.0001, Aligned region: 87..125
BON [PF04972], Evalue: 0.0001, Aligned region: 159..178
Protein Sequence: 316 a.a.     [Download]
>gi|115350445|ref|YP_772284.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria AMMD]
MQRTIHIRRARLSPFVAALVVAGLVGSGAAYAQNTGGATVTPVGNGTVATAALPANTNPAAAPAAGSGTV
VHGTAGTIAPPPANATPGQVVAGGKVPDEATKAAVLQKLRDTYGAANVVDQIEVGDVATPPNWSANVQKL
LGAQLKQISKGQLKINGTQIEVKGEVHNEAQRQQLASDMANTLNPTYTIKNGLRVSASEQGLLDQTLANR
TIEFETGSATLTPQGRQILDQMAAALSKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIP
PQQMTTTGVGPDQPIAPNDTADGRARNRRIEFRVGQ
 
Nucleotide Sequence: 951 bp     [Download]
>gi|115350056|ref|NC_008390.1|:c438686-437736 Burkholderia ambifaria AMMD chromosome 1, complete sequence
ATGCAACGCACGATTCACATCCGCCGCGCGCGCTTGTCGCCCTTCGTGGCCGCCCTCGTCGTCGCCGGGC
TCGTCGGCAGCGGCGCGGCCTACGCGCAGAACACGGGCGGCGCGACCGTCACGCCGGTCGGCAACGGCAC
GGTCGCGACCGCCGCCCTACCCGCGAATACCAACCCCGCCGCCGCGCCGGCCGCGGGGTCCGGCACGGTG
GTGCACGGCACGGCCGGCACGATCGCGCCGCCGCCCGCGAACGCGACGCCCGGCCAGGTGGTGGCCGGCG
GCAAGGTGCCCGACGAGGCGACCAAGGCCGCCGTGTTGCAGAAGCTGCGCGACACCTACGGCGCGGCGAA
CGTGGTCGACCAGATCGAGGTCGGCGACGTCGCGACGCCGCCGAACTGGAGCGCGAACGTGCAGAAACTG
CTCGGCGCGCAGCTCAAGCAGATCAGCAAGGGCCAGTTGAAGATCAACGGCACGCAGATCGAGGTGAAGG
GCGAGGTGCATAACGAAGCGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACACGCTGAACCCGACGTA
TACGATCAAGAACGGGCTGCGTGTGTCGGCGTCCGAGCAGGGGCTGCTCGACCAGACGCTCGCGAACCGC
ACGATCGAGTTCGAGACGGGCAGCGCGACGCTCACGCCCCAAGGCAGGCAGATTCTCGATCAGATGGCGG
CCGCGCTGTCGAAGTTGCAGAACCGCACGGTCGACATCATCGGCCACACCGACAACTCGGGGAACCGGAC
GTCGAACATCGCGCTGAGCCAGGCGCGCGCGGATGCGGTGAAGGGGTATCTGATCACGAAGAGCATCCCA
CCGCAGCAGATGACGACGACGGGGGTCGGGCCGGATCAGCCTATTGCGCCGAATGATACGGCGGACGGAC
GGGCGAGGAATCGACGGATCGAGTTTCGGGTGGGGCAGTAA