SecReT6
Protein ID: 115358217
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3467
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]264557..265660 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDQ0BA02
KEGG IDbam:Bamb_3467
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-21, Aligned region: 71..131
ImpA-rel_N [PF06812], Evalue: 2.40E-21, Aligned region: 221..234
Protein Sequence: 367 a.a.     [Download]
>gi|115358217|ref|YP_775355.1| ImpA domain-containing protein [Burkholderia ambifaria AMMD]
MSKKPSPRQSISGKATAKDTPHHDWLAPVSNAMPCGPDLEYDHDFVVLFTSAAPRQDVQYGAFVGAPDPV
NWSEIERDCQRLMLRTKDIRVAVLYTRSRTRLAGAAGLADGTGLLAAWLDAFAEQVHPQPDVDGGRDAAR
EMRMNAIQALADPAGLLADVREIVLSKSTLARLQVRDVERAFAHPRPADALAPESVTQQLQDVRAQQPEV
MAGFDDAITHLAAIDAWCAVHLDGYLPELSSLTRLLGRLKAPASANAIEQLEESYDPPSAASESSGRDAS
APLEPPNDGPVSATERMTAPPGSAPTDRQAALALIRTARTWFETHEPSSPIPVLLKRAEQFVGKPYAEVV
TAIPAELLAQWEETESG
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|115357970|ref|NC_008391.1|:c265660-264557 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGAGCAAAAAGCCGTCACCCCGACAGTCCATATCCGGTAAAGCTACCGCGAAGGACACCCCGCATCACG
ACTGGCTCGCGCCCGTGAGCAACGCCATGCCCTGCGGCCCCGACCTCGAATATGACCACGATTTCGTGGT
GCTGTTCACGAGTGCGGCGCCCAGGCAGGACGTGCAGTACGGCGCATTCGTCGGTGCCCCCGATCCGGTC
AACTGGAGCGAGATCGAACGCGACTGCCAGCGGCTCATGCTCCGCACGAAGGATATTCGAGTCGCTGTGT
TGTACACGCGAAGCCGCACGCGGCTCGCCGGTGCCGCAGGTCTTGCAGATGGCACAGGATTGCTGGCCGC
CTGGCTCGATGCGTTTGCCGAACAGGTGCATCCACAGCCCGATGTCGACGGTGGGCGCGACGCCGCACGT
GAAATGCGGATGAATGCGATACAGGCGCTTGCCGATCCGGCCGGACTGCTCGCCGACGTGCGCGAGATCG
TGCTTTCGAAGTCGACGCTCGCGCGACTGCAGGTGCGCGATGTCGAGCGTGCGTTTGCGCACCCCCGCCC
CGCCGATGCTCTCGCGCCCGAGTCCGTTACGCAGCAGTTGCAGGATGTGCGCGCGCAACAGCCCGAAGTG
ATGGCAGGTTTCGACGATGCGATTACGCATCTCGCTGCAATCGATGCATGGTGCGCCGTGCATCTCGACG
GCTACCTGCCGGAACTGTCGTCGCTCACGCGGCTCCTCGGCAGGTTGAAGGCGCCCGCGTCGGCGAACGC
GATCGAGCAGTTGGAAGAATCCTATGATCCCCCATCCGCCGCCAGCGAATCATCAGGCCGTGATGCGTCA
GCGCCGCTCGAACCGCCGAATGACGGACCGGTTAGCGCCACCGAGCGCATGACGGCCCCACCGGGATCCG
CACCGACGGACCGTCAGGCCGCGCTCGCTCTGATTCGTACGGCGCGAACGTGGTTCGAGACCCACGAACC
CAGCAGCCCGATTCCTGTGTTGCTCAAACGTGCGGAGCAGTTCGTCGGCAAGCCTTACGCCGAGGTCGTC
ACGGCAATTCCTGCCGAGCTTCTCGCGCAGTGGGAAGAAACCGAGAGTGGTTGA