SecReT6
Protein ID: 115358219
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3469
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]266730..268619 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ0BA00
KEGG IDbam:Bamb_3469
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-219, Aligned region: 5..629
Protein Sequence: 629 a.a.     [Download]
>gi|115358219|ref|YP_775357.1| hypothetical protein Bamb_3469 [Burkholderia ambifaria AMMD]
MDPRLLDYYNQELIYMRELATEFAQAHPKIARRLGMQAGEVADPYVERLIESFCFMAARLQLKLDAEFPR
FTGRLLEVIYPNYVAPTPSIAVARLYPGQAEGNLAAGYRIARGTSFKARVPDGEKTACQFTSGQDVTLWP
LTITDARLTGIPPDIPALDRHVPPDRQVRGALRLRLATTGDVRIADLKGLDRLPVYLAGDEQVASHLFEL
LHVAGVASVIAAPGEFGVPGRSPAAVIHGAVEHEGLGTDQNLLPLTWTKFHGHNLLHEYFACPARFWFFA
LNGLAEGLSRVNGREVEIVVLLDRAPGQLANLVDASRFALFCTPVINLFKRHTDRIEISPRETEFHLVPA
RLAPLDYEVFSVETVYGQVAATSDELEFRPLYQTLNNDEGNHGRYFSTRRERRLASDSARRYGTRTPYVG
TEVFLSLVDQNEAPYGEDIRFLSVDALLTNRDLATLVPRDGVRDLAMEESAPVESIGLIRPPSPPKAPYA
EREMAWRLIRQLNFNYLPLEGLDHRDGGQGLRDLLRLYLSNDNNEHSRQVESLVGVNTRPVTRKLPGTGP
MTFGRGIECAVTVDEAGFSGVSPYLFGTILEHWLARHVSINSFTQTELHSMQRGRIARWPVRTGTRGVL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|115357970|ref|NC_008391.1|:c268619-266730 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGGACCCGCGACTACTCGACTATTACAACCAGGAACTCATCTACATGCGCGAGCTCGCCACCGAGTTCG
CACAGGCGCACCCGAAAATCGCGCGCCGGCTCGGCATGCAGGCCGGTGAAGTGGCGGACCCCTACGTCGA
ACGCCTGATCGAGTCGTTCTGCTTCATGGCCGCGCGCCTGCAGCTCAAGCTCGATGCCGAGTTTCCACGC
TTCACGGGGCGGCTGCTGGAAGTGATCTACCCGAATTACGTCGCGCCCACGCCGTCGATCGCGGTCGCGC
GCCTGTATCCCGGTCAGGCCGAAGGCAATCTGGCCGCCGGCTATCGTATCGCGCGCGGCACGTCGTTCAA
GGCGCGGGTTCCGGATGGCGAAAAAACCGCTTGCCAGTTTACGAGCGGACAGGACGTCACGCTCTGGCCG
CTCACGATCACCGATGCACGGCTGACGGGTATTCCGCCTGACATTCCGGCGCTCGACCGCCATGTTCCGC
CCGACCGACAGGTGCGCGGTGCATTGCGGCTGCGGCTGGCGACGACCGGCGACGTGCGCATCGCCGATCT
GAAGGGGCTCGACCGGTTGCCCGTGTATCTGGCCGGTGACGAACAGGTCGCCTCGCACCTGTTTGAGCTG
CTGCACGTCGCCGGCGTCGCATCCGTGATTGCCGCGCCCGGAGAATTCGGCGTACCGGGCCGCTCTCCCG
CCGCCGTGATTCACGGTGCGGTCGAACACGAGGGCTTGGGCACCGATCAGAACTTGCTGCCACTCACCTG
GACGAAGTTCCACGGACACAACCTGCTGCACGAATACTTCGCGTGCCCGGCAAGGTTCTGGTTCTTCGCA
CTCAACGGCCTTGCCGAAGGCCTGTCCCGCGTGAACGGTCGCGAGGTCGAAATCGTCGTGCTGCTCGACC
GGGCGCCCGGCCAGCTCGCGAACCTTGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCCGTCATCAA
CCTCTTCAAACGGCACACGGATCGCATCGAGATTTCTCCCCGCGAGACCGAATTTCATCTGGTACCCGCG
CGACTCGCACCGCTGGACTATGAAGTGTTTTCGGTAGAGACGGTGTACGGGCAGGTCGCAGCGACCTCGG
ACGAACTGGAATTCCGTCCGCTGTATCAAACGCTGAACAACGACGAAGGTAACCACGGGCGGTACTTCTC
GACACGGCGCGAACGGCGGCTCGCGTCCGATTCGGCTCGCCGTTACGGCACGCGAACTCCTTATGTCGGC
ACCGAAGTGTTTCTCTCGCTGGTTGACCAGAACGAGGCTCCCTACGGTGAAGACATCCGTTTCCTGTCAG
TCGATGCGCTGCTGACGAACCGGGATCTCGCCACGCTCGTGCCGCGCGACGGCGTGCGTGACTTGGCAAT
GGAGGAGTCCGCACCCGTCGAAAGCATCGGTCTCATTCGCCCGCCGAGTCCGCCCAAAGCCCCGTATGCG
GAGCGAGAGATGGCATGGCGCCTGATCCGCCAGCTCAACTTCAACTACCTGCCGCTCGAAGGTCTCGATC
ACCGTGACGGCGGTCAGGGACTACGCGACCTGCTGCGCCTATACCTTTCGAACGACAACAACGAACATTC
GCGGCAAGTCGAAAGCCTCGTCGGCGTCAACACTCGCCCGGTAACACGCAAGCTGCCGGGCACGGGTCCG
ATGACGTTCGGGCGTGGCATCGAGTGTGCAGTGACAGTCGACGAGGCAGGCTTCTCCGGCGTCAGCCCCT
ATCTATTCGGTACGATTCTCGAGCACTGGCTGGCACGGCACGTGTCGATCAACAGCTTCACGCAGACCGA
ATTGCATTCGATGCAGCGCGGCCGTATCGCACGCTGGCCCGTGCGCACCGGGACACGCGGAGTGCTGTGA