SecReT6
Protein ID: 115358220
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3470
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]268652..269209 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ0B9Z9
KEGG IDbam:Bamb_3470
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-20, Aligned region: 51..163
Protein Sequence: 185 a.a.     [Download]
>gi|115358220|ref|YP_775358.1| hypothetical protein Bamb_3470 [Burkholderia ambifaria AMMD]
MTEHKRPLTRGNSLVARPPRRANAHLMPTLLDRLRDDAPHRLIEAPEEYAVTRKQMRDIVQRDLAYLLNT
TSIEDRIERERHPQAAASTVNFGVPPLAGTFLASRQWNDIERMIRQAITDFEPRLIPGSLAVSPRHGDDA
SGHHNVLAFEVRGLVHMDPYPLEFMVQSSLDLETSEIQITGMRSG
 
Nucleotide Sequence: 558 bp     [Download]
>gi|115357970|ref|NC_008391.1|:c269209-268652 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGACTGAGCACAAGCGACCTCTCACGCGGGGCAACTCGCTCGTCGCGCGCCCGCCGCGGCGGGCAAACG
CGCATCTGATGCCGACCCTGCTCGACCGGCTACGGGACGACGCACCGCATCGGCTCATCGAGGCACCCGA
GGAATATGCCGTCACACGCAAGCAGATGCGCGACATCGTCCAGCGCGATCTCGCCTATCTGCTCAACACG
ACAAGCATTGAAGATCGGATCGAGCGCGAACGCCACCCACAGGCGGCCGCATCGACCGTCAATTTCGGCG
TGCCGCCGCTCGCGGGCACCTTTCTCGCGTCGCGCCAGTGGAACGACATCGAGCGGATGATCCGGCAGGC
CATCACCGATTTCGAACCGCGGCTGATCCCCGGTTCGCTGGCGGTGTCGCCCCGTCACGGCGACGACGCC
AGCGGCCATCACAATGTGCTCGCGTTCGAGGTGCGCGGCCTGGTTCACATGGACCCATATCCGCTCGAAT
TCATGGTGCAGAGCTCGCTCGATCTCGAGACGAGCGAAATCCAGATCACCGGCATGCGCTCCGGGTAG