SecReT6
Protein ID: 115358221
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3471
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]269202..270053 [-]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDQ0B9Z8
KEGG IDbam:Bamb_3471
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.30E-52, Aligned region: 150..267
Protein Sequence: 283 a.a.     [Download]
>gi|115358221|ref|YP_775359.1| virulence protein, SciE type [Burkholderia ambifaria AMMD]
MKMPFAAEEPSGHGRDDVPIAAQIERIESHIRAQPTFAAHRWALFQWLCVTGDWARAVIQLQTWAKLEPQ
QTQAAQVYRDLVRAERWRQKVVAGFERPGFVLEPAPWVMELAFALRLARDGQRGHADEAREKALDAAPLI
AAHTPRGGASWIADSDSRFGPVCEVMTAGHYRWVPFADLAAWRMAPPANLIDLVWASCVLTLTDGSTVHG
FMPARYPGSEAATDALRLGRETAWHEAGRTAVIAHGQKTWTTDRGDFGLFELAHAQFGSRVADGATTGEP
VDD
 
Nucleotide Sequence: 852 bp     [Download]
>gi|115357970|ref|NC_008391.1|:c270053-269202 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGAAGATGCCATTTGCAGCCGAAGAACCGTCTGGCCACGGCCGTGACGATGTGCCGATCGCCGCGCAGA
TCGAGCGGATCGAGTCGCATATTCGTGCGCAGCCGACCTTCGCCGCCCATCGGTGGGCGCTGTTCCAGTG
GCTGTGCGTAACAGGCGACTGGGCACGCGCCGTGATTCAACTGCAGACGTGGGCAAAGCTTGAGCCGCAA
CAAACGCAGGCCGCCCAGGTTTATCGTGACCTGGTCCGGGCCGAGCGCTGGCGACAGAAGGTTGTCGCGG
GATTCGAACGCCCTGGGTTCGTCCTCGAACCGGCTCCGTGGGTCATGGAACTGGCATTCGCACTGCGACT
TGCTCGCGACGGGCAACGCGGACACGCCGACGAAGCGCGAGAAAAAGCACTCGACGCGGCGCCGCTCATC
GCAGCGCACACGCCCCGGGGGGGCGCGAGCTGGATCGCCGACAGCGATTCGCGTTTCGGACCGGTGTGCG
AAGTCATGACGGCCGGACACTACCGCTGGGTACCGTTCGCCGATCTCGCCGCGTGGCGCATGGCCCCGCC
TGCGAACCTCATCGATCTCGTCTGGGCGTCGTGTGTGCTGACACTGACCGACGGCAGTACCGTGCACGGC
TTCATGCCTGCCCGCTACCCCGGCTCGGAGGCCGCGACCGATGCACTGCGTCTGGGGCGCGAAACGGCCT
GGCATGAGGCTGGACGTACCGCCGTCATCGCGCACGGACAAAAAACCTGGACAACGGATCGGGGCGATTT
CGGTCTATTCGAACTGGCCCACGCGCAGTTCGGCTCGCGTGTTGCGGACGGCGCCACCACCGGAGAGCCG
GTCGATGACTGA