SecReT6
Protein ID: 115358224
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3474
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]273986..274528 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ0B9Z5
KEGG IDbam:Bamb_3474
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-60, Aligned region: 11..165
Protein Sequence: 180 a.a.     [Download]
>gi|115358224|ref|YP_775362.1| hypothetical protein Bamb_3474 [Burkholderia ambifaria AMMD]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPVEPLPAVSDRRFLEIDIDN
FDERMKAIRPRVAFAVSNTLTGDGQMMVDMTFESMEDFSPAAIARKVEPLRQLLEARTQLANLQTYMDGK
SGAEALVTQLLHDPALLKSLAAAPKPERQADETADQDDTN
 
Nucleotide Sequence: 543 bp     [Download]
>gi|115357970|ref|NC_008391.1|:273986-274528 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGTCCGCTTCCAGCAGTTCGCAGAAATTCATTGCGCGCAACCGTGCGCCGCGTGTGCAGATCGAGTACG
ACGTCGAGGTCTACGGCTCGGAGAAGAAAGTCGAGCTGCCGTTCGTGATGGGGGTGCTCGCCGATCTGTC
GGGGAAGCATCCGGTCGAGCCGCTACCGGCGGTGTCGGACCGGCGCTTCCTCGAGATCGACATCGACAAT
TTCGATGAGCGCATGAAGGCGATCCGGCCGCGCGTCGCGTTCGCCGTATCGAATACGCTGACGGGCGACG
GCCAGATGATGGTCGACATGACCTTCGAGAGCATGGAGGACTTTTCACCGGCTGCGATTGCCCGCAAGGT
CGAGCCGCTGCGCCAACTGCTGGAAGCGCGTACGCAACTCGCCAATCTGCAGACCTACATGGATGGCAAG
TCGGGTGCAGAGGCGCTCGTCACGCAGTTGCTGCATGACCCGGCGCTGCTCAAATCGCTGGCTGCCGCGC
CGAAGCCCGAGCGGCAAGCGGACGAAACTGCCGATCAAGACGACACGAACTGA