SecReT6
Protein ID: 115358226
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3476
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]276142..276627 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ0B9Z3
KEGG IDbam:Bamb_3476
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.60E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|115358226|ref|YP_775364.1| hypothetical protein Bamb_3476 [Burkholderia ambifaria AMMD]
MAQDIFLKIDGINGESLDEKHKDEIEVLTWEWDIQQESTMHAGSGGGAGKATVKDLTFEHNIDRASPNLM
KYALTGKHIDQATLVMRKAGGNPLEYLKLTMSDVIVTRVKPSGSKNDAEKSRESVSLSFAKVKQEYVVQN
AQGGSGGAVTASFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|115357970|ref|NC_008391.1|:276142-276627 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGGCACAAGATATTTTCCTGAAGATCGACGGCATCAACGGCGAGTCGCTTGACGAAAAGCACAAGGACG
AAATCGAGGTTCTGACCTGGGAGTGGGACATCCAGCAGGAATCGACGATGCACGCCGGCAGCGGCGGCGG
TGCCGGCAAGGCGACCGTCAAGGATCTGACGTTCGAACACAACATCGACCGCGCGAGCCCGAACCTGATG
AAGTACGCGCTCACGGGCAAGCACATCGACCAGGCAACGCTGGTCATGCGCAAGGCCGGCGGCAACCCGC
TTGAATACCTGAAGCTCACGATGAGCGACGTGATCGTCACGCGCGTGAAGCCGTCGGGCAGCAAGAACGA
TGCGGAAAAGAGCCGCGAATCGGTGTCGCTGTCGTTCGCGAAGGTCAAGCAGGAATACGTCGTGCAGAAC
GCGCAGGGCGGCAGTGGTGGCGCCGTGACCGCGAGCTTCGACATCAAGGGCAACAAGGAAGCGTAA