SecReT6
Protein ID: 115358227
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3477
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]276714..277220 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ0B9Z2
KEGG IDbam:Bamb_3477
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.70E-43, Aligned region: 13..161
Protein Sequence: 168 a.a.     [Download]
>gi|115358227|ref|YP_775365.1| hypothetical protein Bamb_3477 [Burkholderia ambifaria AMMD]
MRSIPTVATLACALALSACASSGEPKPKEPIRLDMRVNARPDVNPDDRGWAAPIVVRIYELKNDGAFNAA
DFFTLQTRDKTALADDVVKRDELQLRPGEHQTLVRRPDPVTTTIGVIAAYRDLPNAVWRAVYTMPAAPDK
AWYRLFTSKLKLTIDLEAKAVKITEAKK
 
Nucleotide Sequence: 507 bp     [Download]
>gi|115357970|ref|NC_008391.1|:276714-277220 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGCGTTCGATACCGACCGTCGCCACGCTCGCCTGCGCGCTCGCGCTTTCCGCCTGTGCGAGCAGTGGCG
AACCGAAGCCGAAGGAGCCGATCCGGCTCGACATGCGCGTGAACGCGCGGCCCGACGTCAATCCGGACGA
CCGGGGATGGGCTGCGCCGATCGTCGTGCGCATTTACGAACTGAAGAACGACGGCGCCTTCAACGCGGCC
GACTTCTTCACGCTGCAGACCCGGGACAAAACGGCGTTGGCCGACGACGTTGTGAAACGCGACGAGCTGC
AGTTGCGCCCCGGTGAGCACCAGACGCTCGTTCGCCGGCCCGATCCGGTCACGACCACCATCGGCGTGAT
CGCGGCTTATCGTGATTTGCCGAACGCGGTTTGGCGCGCGGTCTACACGATGCCGGCCGCACCGGACAAG
GCGTGGTACCGCTTGTTCACGTCGAAGCTGAAACTGACCATCGATCTCGAGGCCAAGGCCGTCAAGATCA
CGGAAGCCAAGAAATGA