SecReT6
Protein ID: 115358228
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3478
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]277252..278595 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ0B9Z1
KEGG IDbam:Bamb_3478
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-143, Aligned region: 20..447
Protein Sequence: 447 a.a.     [Download]
>gi|115358228|ref|YP_775366.1| hypothetical protein Bamb_3478 [Burkholderia ambifaria AMMD]
MSWYAKVAWQEGLFFRPQLFQQQDRYFEKYAHQRAAPLSPFFFGFTHFALDHEALALGKVVVKAAAGVFA
DGTPFDAPGNTPLPPPLTIRPEHLDQVIYLAVPVRLPNCEETTFDETPDSLARYQVFDTELRDTNSMGLA
PESVQLSNLRVRLLPEKELGDAWIGLALTRVTTIRADGSIALDDTLVPPVSGYGASDLLTSWVTKIHDLA
RLRANALAQRLAGTDDTTASAATVTDYLLLQILNRYEPLLQHLLRVPATSPADVYALLIGMAGELSTHLR
TNTRRPLDTHPPYQHTTPHVCLKPVVDDTHRLLNAVLVRSAQSIVLEDRGHGMRNAVVDPVDMQGFAALV
LAVHAAMPQDVLQQQFLAQAKAGPSDKLPSLVRSHLPGIGLQALPVPPRQIPFNAGYIYYELTQGGLLWE
EVVRHGGIALHVSGEFPSLRLELWGVR
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|115357970|ref|NC_008391.1|:277252-278595 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGAGCTGGTACGCCAAGGTCGCCTGGCAGGAGGGGCTGTTCTTCCGTCCGCAGCTGTTCCAACAGCAGG
ATCGCTATTTCGAGAAATACGCGCATCAGCGCGCGGCGCCGCTGTCGCCGTTCTTTTTCGGTTTCACGCA
CTTCGCGCTCGACCACGAGGCGCTTGCGCTCGGCAAGGTGGTTGTCAAGGCGGCCGCGGGCGTGTTTGCC
GACGGCACGCCGTTCGATGCGCCGGGCAACACGCCGTTGCCGCCGCCGCTGACGATCCGGCCCGAACATC
TGGACCAGGTGATCTATCTGGCCGTACCCGTCCGGTTGCCGAATTGTGAGGAGACCACCTTCGACGAAAC
CCCGGATTCGCTCGCACGCTATCAGGTGTTCGACACCGAATTGCGTGACACGAATTCGATGGGTCTTGCC
CCCGAATCGGTGCAGTTGTCGAACCTGCGCGTGCGTCTGCTGCCGGAAAAGGAGCTGGGCGATGCCTGGA
TCGGTCTCGCGCTCACGCGTGTGACGACGATTCGCGCGGATGGCAGCATCGCGCTCGACGACACGCTCGT
GCCGCCGGTATCCGGTTACGGCGCAAGCGACCTGCTGACAAGCTGGGTCACGAAAATTCATGATCTCGCG
CGCCTGCGCGCGAATGCGCTTGCGCAGCGGCTCGCCGGTACCGACGACACGACCGCAAGCGCGGCGACAG
TTACCGATTACCTGCTGCTGCAGATCCTGAACCGCTACGAGCCGCTTCTGCAGCATCTGCTGCGTGTGCC
GGCGACGTCGCCGGCTGACGTGTATGCGCTGCTGATCGGCATGGCGGGGGAGTTGTCGACGCATTTGCGC
ACCAACACGCGCCGGCCACTCGATACGCACCCGCCGTATCAGCATACGACGCCGCACGTGTGCCTGAAGC
CGGTCGTCGACGACACGCATCGCCTGCTCAACGCCGTGCTGGTGCGCAGCGCGCAGAGCATCGTGCTCGA
GGATCGCGGTCACGGCATGCGTAACGCGGTGGTCGATCCGGTCGATATGCAAGGGTTCGCCGCACTGGTG
CTGGCCGTGCATGCGGCGATGCCGCAGGATGTACTGCAACAGCAGTTTCTTGCGCAGGCGAAGGCGGGGC
CTTCGGACAAGCTGCCTAGCCTGGTGCGCAGTCACTTGCCGGGCATCGGCCTGCAGGCGCTGCCGGTGCC
GCCGCGGCAGATTCCGTTCAACGCGGGCTACATCTATTACGAGCTGACCCAGGGTGGACTGCTTTGGGAG
GAAGTCGTGCGGCATGGTGGCATCGCATTGCATGTGTCGGGAGAGTTCCCGTCATTGAGGCTTGAGTTAT
GGGGCGTGCGCTGA