SecReT6
Protein ID: 115358229
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3479
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]278884..281421 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ0B9Z0
KEGG IDbam:Bamb_3479
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-71, Aligned region: 35..379
DUF2345 [PF10106], Evalue: 2.50E-48, Aligned region: 663..814
T6SS_Vgr [PF13296], Evalue: 2.30E-35, Aligned region: 524..633
Phage_base_V [PF04717], Evalue: 2.50E-18, Aligned region: 432..511
Protein Sequence: 845 a.a.     [Download]
>gi|115358229|ref|YP_775367.1| Rhs element Vgr protein [Burkholderia ambifaria AMMD]
MALFDAPRTLSVSGAALPMYGDRPILTPVKLTGGETIGELFEYTLELKTPDALGFSQSIAANVKLDKLIG
TEVTVSIQLEGKGRFIPGLVGSAGMANLGAGAREITGIVSHATIVREDGRSIVYALTLRPWLWHATKNCD
CRIFQDMSVVEITDAVLSSYPFPVEKRLTTPRPNKGWPKRDIQRQHFESDWAFLQRLWEEWGIYYFFEHS
EGKHRLVLCDSMGALKPLGEAYAALRYEPPTGRRLDEEHIQDFSVSHALTTGAVTSVDYDYTLPRADLKV
MREDPRDTGLAHQEHYTWGDYAQPQAGAAGLSGDHNEPRTEAEYLTLVQMEAWRCQGLRAYGKGNLRGVV
TGQSFVLSHYPQDAANREYAVIACKLTIEEIGEASGSGQRYRCEADFTVQPTNEPFRLLRTIAKPRMNGV
EYAVVTCPENQEIWTDAQGRVKLQFLWDRLGKNDERSSCWVRVAGAWHGDQFGGVFLPRRGHEVEVAFVN
GDPDLPIIVGSATNAFNMPPFDLPKNQALAGYRSREIGGRRANTLAFDDTNGKIQAHLSSDEGASQLNLG
YITRIAGSAGRQNERGRGFELVTSLWGVVRSAMGMLITTEARPDTQGHAKDMGETVRRLTDARDTHERLA
ELAQQNLAQDANVDQSEVTAALRAQNDAIRGGAMSDDAPFPEFVEPHLTLASPVGIQTTTAGSTHVASGE
HLALTTGEHFGIATGRSLFATVKEKLRIFVYEAGIKLIAGAGSIDIEALKDAINLMAKIRIRQTATRIEI
WAEEELSLRGGKSFITLNHSGITNGTPGQWQSYAATHQMPGPKSSPGDVPAAELKVCELSTVKAAAQHAA
IVPLS
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|115357970|ref|NC_008391.1|:278884-281421 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGGCTTTGTTTGACGCACCACGGACGCTGTCGGTTTCCGGCGCGGCTCTGCCGATGTACGGTGATCGTC
CGATTCTCACGCCGGTCAAGCTTACCGGTGGCGAGACGATCGGCGAGTTGTTCGAGTACACGCTCGAACT
GAAAACGCCGGATGCGCTCGGGTTTTCGCAGAGCATCGCGGCGAATGTCAAACTCGACAAGCTGATCGGC
ACGGAAGTGACCGTGTCGATTCAGCTCGAGGGCAAGGGCCGCTTCATCCCCGGCTTGGTCGGGAGTGCCG
GAATGGCCAATCTTGGTGCGGGCGCACGCGAGATCACCGGTATCGTCAGCCATGCGACGATCGTGCGTGA
AGACGGTCGTTCGATCGTCTATGCACTCACGCTGCGGCCGTGGCTCTGGCATGCGACCAAGAATTGTGAC
TGCCGAATCTTTCAGGATATGTCCGTTGTCGAGATCACCGATGCGGTGCTCTCGTCCTATCCGTTCCCGG
TCGAAAAACGCCTTACCACCCCTCGGCCGAACAAGGGATGGCCGAAGCGGGACATTCAGCGTCAGCACTT
CGAGAGCGACTGGGCGTTCCTGCAGCGTTTGTGGGAAGAGTGGGGCATCTACTACTTCTTCGAGCATAGC
GAAGGCAAGCATCGCCTTGTGCTGTGCGACTCAATGGGTGCGCTCAAACCGCTAGGTGAAGCTTATGCAG
CGCTTCGCTACGAGCCGCCGACCGGTCGACGGCTTGACGAGGAACACATTCAGGACTTCTCGGTCTCCCA
TGCGCTGACAACGGGCGCGGTGACGAGCGTCGACTACGACTATACGTTGCCGCGCGCGGACCTGAAGGTG
ATGCGCGAAGATCCTCGTGACACCGGGCTCGCTCATCAGGAGCATTACACATGGGGCGATTACGCGCAGC
CGCAAGCTGGCGCGGCTGGGCTCTCGGGCGATCACAACGAGCCGCGCACGGAAGCGGAGTACCTGACTCT
CGTGCAGATGGAGGCTTGGCGTTGTCAGGGGCTGAGGGCCTATGGCAAAGGCAACCTGCGGGGCGTGGTG
ACCGGGCAGTCGTTCGTGCTGTCGCATTATCCGCAGGATGCGGCGAATCGCGAGTATGCGGTGATCGCCT
GCAAGCTGACAATCGAGGAGATTGGCGAAGCGTCGGGATCCGGCCAGCGATACCGTTGCGAAGCGGATTT
TACGGTGCAGCCGACCAATGAGCCGTTCCGGCTGCTGCGTACGATTGCAAAGCCACGTATGAACGGCGTC
GAATATGCCGTCGTGACGTGTCCGGAGAATCAGGAAATCTGGACCGATGCACAGGGTCGGGTAAAGCTCC
AGTTTCTGTGGGATCGGCTGGGCAAGAACGATGAGCGATCGAGTTGCTGGGTACGTGTGGCCGGTGCCTG
GCATGGCGATCAGTTCGGTGGAGTTTTCCTGCCGCGACGGGGGCATGAAGTCGAGGTCGCGTTCGTCAAT
GGTGATCCGGATTTGCCGATCATCGTGGGCAGCGCGACCAATGCGTTCAACATGCCACCGTTCGACTTGC
CGAAGAACCAGGCGCTCGCCGGCTATCGTAGCCGCGAGATCGGCGGTCGGCGCGCGAATACGCTCGCCTT
CGACGATACGAACGGGAAAATCCAGGCGCATCTGTCGAGCGACGAAGGCGCCTCGCAGTTGAATCTTGGG
TATATCACACGTATTGCCGGGAGTGCGGGGCGTCAGAATGAGCGTGGTCGGGGCTTCGAGTTAGTAACGA
GCCTGTGGGGCGTGGTGCGCTCGGCGATGGGAATGCTGATTACGACTGAGGCACGGCCGGATACGCAGGG
ACATGCCAAGGATATGGGTGAGACGGTCCGGCGACTCACGGACGCGCGCGACACCCACGAACGTTTGGCC
GAGCTGGCTCAGCAAAACTTGGCGCAGGACGCGAACGTCGATCAAAGTGAGGTCACGGCCGCGTTGAGGG
CCCAGAACGATGCGATACGAGGTGGAGCAATGTCAGACGATGCCCCGTTTCCGGAGTTTGTCGAGCCACA
CCTGACGCTTGCCAGTCCAGTTGGCATCCAGACAACAACAGCGGGTAGCACGCACGTCGCAAGCGGTGAG
CACTTGGCGTTGACGACGGGCGAGCATTTTGGCATTGCGACTGGACGATCACTGTTTGCAACCGTCAAGG
AAAAATTGCGGATCTTTGTCTACGAGGCGGGGATCAAGCTTATTGCCGGCGCTGGCTCAATCGACATCGA
AGCCCTCAAGGACGCCATTAACCTGATGGCGAAAATCAGGATCCGGCAGACTGCGACACGGATTGAAATC
TGGGCCGAAGAGGAACTATCGCTACGTGGCGGGAAGAGTTTCATCACGCTCAATCATTCCGGTATTACCA
ACGGCACGCCGGGACAGTGGCAGTCCTATGCCGCAACTCACCAGATGCCGGGACCGAAAAGTTCGCCGGG
AGATGTGCCGGCCGCCGAACTAAAGGTCTGTGAGTTGAGTACGGTCAAAGCGGCGGCTCAGCATGCGGCG
ATCGTGCCGCTTTCGTGA