SecReT6
Protein ID: 115358234
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3484
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]286100..287398 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ0B9Y5
KEGG IDbam:Bamb_3484
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.50E-63, Aligned region: 57..267
OmpA [PF00691], Evalue: 2.30E-17, Aligned region: 326..424
Protein Sequence: 432 a.a.     [Download]
>gi|115358234|ref|YP_775372.1| hypothetical protein Bamb_3484 [Burkholderia ambifaria AMMD]
MMDRAKYLGGQKEDVSVPVDAPTFADTVDPDRNQKTYVIPPGKVESLRLNAILAARNPLLEASRVLLRAQ
ADMPETFESRDAVVLLRRLLVEEVRVFDRLCEQANIRRDHMIGASYCLCTALDEAVAQTAWGKEGSSAIE
WIQGGLATTFHGDLKGGDKVYLLIGRLLEDPHEHRELLEVIYRILSLGFEGRYRGVTDGKRKHDGIRQRL
YNVITSQREPVPLALSPHWQSTAKGKRLSFTDFPVWITVTVLSVILLGLFGWFKYELVSRSADVQKQIAD
IARMTPPPAPPQLHLKQLLQDEIAAGTVSVDEDARHSAVTFRGDAMFKPGGASVQASMNPLIAKIATEIA
KVPGKVTIIGYTDKVPIRSRHFASNQVLSEERATQVMQMLQAAGVPANRLEAVGKGDAHPVGDNRTAQGR
AQNRRVEIDVAR
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|115357970|ref|NC_008391.1|:286100-287398 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGATGGATCGTGCGAAATATCTGGGTGGCCAGAAGGAGGACGTATCGGTTCCCGTCGATGCTCCAACGT
TTGCCGATACCGTCGACCCCGATCGAAACCAGAAGACTTACGTCATCCCGCCGGGAAAAGTGGAATCGCT
GCGACTGAATGCAATTCTGGCAGCACGGAACCCGTTGCTCGAGGCATCGCGTGTGCTGCTGCGTGCGCAG
GCCGACATGCCCGAGACGTTTGAGTCGAGAGATGCGGTCGTGCTGTTGCGTAGGCTTCTCGTGGAGGAGG
TTCGCGTATTCGACAGGCTTTGCGAGCAAGCAAACATCCGGCGCGATCATATGATCGGCGCGAGCTACTG
CCTGTGCACGGCACTCGACGAAGCGGTAGCGCAAACCGCATGGGGCAAGGAGGGCTCGTCGGCGATCGAA
TGGATCCAAGGAGGGCTTGCGACCACTTTTCACGGAGACCTCAAGGGCGGCGACAAGGTCTACCTGTTGA
TCGGCCGCTTGCTGGAGGACCCTCACGAGCATCGTGAACTCCTGGAAGTAATTTACCGGATTCTCAGCCT
CGGTTTCGAAGGTCGCTACCGAGGCGTGACCGACGGCAAGCGCAAGCACGACGGGATTCGTCAGCGGCTC
TACAACGTGATCACGTCGCAGCGCGAACCGGTGCCGCTGGCGCTATCGCCTCACTGGCAATCGACCGCGA
AAGGCAAGCGCCTGTCGTTCACCGATTTTCCGGTATGGATCACCGTCACCGTCCTGTCGGTGATCCTGCT
CGGATTGTTCGGCTGGTTCAAGTACGAACTGGTCAGCCGTAGCGCGGACGTTCAGAAACAGATTGCCGAC
ATCGCCCGCATGACGCCGCCTCCCGCGCCGCCGCAACTGCACCTCAAGCAATTGCTCCAGGATGAAATCG
CCGCCGGCACCGTCAGTGTCGACGAAGACGCTCGCCACAGCGCCGTCACGTTCCGCGGAGACGCGATGTT
CAAGCCCGGCGGCGCTTCGGTTCAGGCATCGATGAATCCGCTGATTGCGAAGATCGCCACTGAGATCGCC
AAGGTGCCGGGCAAGGTAACGATCATCGGCTATACAGACAAGGTGCCGATTCGCAGCCGGCATTTCGCAT
CGAATCAGGTGCTGTCGGAAGAGCGCGCCACCCAGGTCATGCAGATGCTGCAAGCCGCTGGGGTGCCGGC
AAACCGTCTCGAAGCCGTCGGCAAAGGCGATGCCCATCCGGTCGGCGACAACCGCACCGCGCAGGGCCGT
GCGCAAAACCGTCGCGTCGAAATCGACGTCGCACGATAA