SecReT6
Protein ID: 115358236
SecReT6 ID149
T6SS typei3
Gene symbol-
Locus tagBamb_3486
StrainBurkholderia ambifaria AMMD
Repliconchromosome II [GenBank: NC_008391] [Browse all T6SS(s) in this replicon]
Location [Strand]291542..292756 [+]
ProductOmpA/MotB domain-containing protein
NoteTssL
UniProt IDQ0B9Y3
KEGG IDbam:Bamb_3486
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.20E-55, Aligned region: 32..246
OmpA [PF00691], Evalue: 2.80E-13, Aligned region: 297..396
Protein Sequence: 404 a.a.     [Download]
>gi|115358236|ref|YP_775374.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria AMMD]
MALSTTDPRGHAGAVASPPVAARLTAAEQAINPLLEASRVLLQALADTPDMLDADAITRWRRWLGQEVRL
FTRISGELQLSPEHVRRASYCLCSALDEAAMQTSWGKGETTGVEWQDNSLASVSGHDRQGGDRVFQLIDE
AMRDPRENLDLIELYQNVLDLGFRGRYRFEAGGHKRLQVIREHVHDAVMTGGLNVNRVSEPPKRTRQTVD
PWVRPVAVRRSRARFVGGLAVALLLGAGGYAAADRWVRTKETRRALPLDALARNLEQRLRDEVAAGNVEL
IRAPGSDALTLRFGGLFAPGDAAVAPWGASVVASAGREIAVLTGSATVHVAGYADSTSARSTRQASNQAL
SEARARHVAQILVSAGVSAPRISVEGNGEADSLADNGTAAGRARNRRVEVTITD
 
Nucleotide Sequence: 1215 bp     [Download]
>gi|115357970|ref|NC_008391.1|:291542-292756 Burkholderia ambifaria AMMD chromosome 2, complete sequence
ATGGCTCTTTCGACAACCGATCCGCGGGGCCACGCAGGCGCCGTGGCGTCGCCGCCTGTTGCCGCGCGGC
TCACGGCCGCGGAGCAGGCGATTAACCCGCTGCTCGAAGCGTCGCGCGTTCTGTTGCAGGCATTGGCCGA
TACGCCCGACATGCTCGATGCCGACGCTATTACACGGTGGCGTCGATGGCTGGGGCAGGAAGTTCGTCTC
TTCACCCGGATCTCCGGTGAACTCCAGCTCAGCCCCGAGCATGTCCGGCGCGCAAGCTATTGTCTGTGCT
CCGCGCTCGACGAGGCGGCGATGCAGACGTCGTGGGGAAAGGGCGAAACAACCGGCGTCGAATGGCAGGA
CAACAGTCTGGCGAGTGTGTCGGGGCATGATCGTCAGGGCGGCGACCGTGTTTTCCAGCTGATCGACGAG
GCCATGCGCGATCCGCGCGAGAACCTCGATCTGATTGAGTTGTACCAAAACGTACTCGATCTCGGGTTTC
GTGGGCGGTACCGATTTGAAGCAGGCGGTCACAAGCGCTTGCAGGTGATTCGCGAACACGTGCACGACGC
GGTTATGACGGGTGGGCTGAACGTGAATCGCGTCAGCGAGCCGCCGAAACGTACGCGACAGACGGTCGAT
CCGTGGGTACGTCCGGTGGCGGTGCGTCGATCGCGAGCGAGGTTCGTAGGAGGTCTCGCTGTTGCGTTAT
TGCTGGGGGCCGGGGGCTACGCCGCGGCGGACCGTTGGGTGCGCACGAAAGAGACCCGCCGGGCTTTGCC
GCTTGATGCGCTCGCTCGAAACCTGGAACAACGGCTTCGCGACGAGGTTGCCGCGGGGAATGTCGAACTG
ATTCGCGCTCCCGGGAGCGATGCGTTGACGCTGCGGTTTGGCGGCCTGTTTGCGCCTGGGGATGCGGCGG
TGGCGCCGTGGGGGGCTTCTGTCGTGGCTTCGGCCGGGCGGGAAATCGCAGTGCTGACCGGCAGTGCAAC
CGTGCATGTGGCGGGCTACGCGGACAGCACGTCGGCCCGTTCGACACGCCAAGCGTCTAACCAGGCGCTT
TCCGAAGCGCGGGCCCGGCACGTGGCCCAGATTCTCGTTTCGGCTGGCGTATCGGCGCCGCGTATCAGTG
TCGAGGGAAATGGCGAGGCCGATTCGCTGGCGGACAACGGAACCGCGGCGGGAAGGGCGAGAAATCGCCG
CGTCGAAGTGACCATCACGGATTGA