SecReT6
Protein ID: 116049603
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_43080
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3832600..3834642 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ02KE4
KEGG IDpau:PA14_43080
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-70, Aligned region: 29..322
Phage_GPD [PF05954], Evalue: 2.90E-70, Aligned region: 527..543
Phage_base_V [PF04717], Evalue: 4.80E-25, Aligned region: 371..464
DUF2345 [PF10106], Evalue: 6.30E-05, Aligned region: 537..574
DUF2345 [PF10106], Evalue: 6.30E-05, Aligned region: 573..616
Protein Sequence: 680 a.a.     [Download]
>gi|116049603|ref|YP_791592.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MFAAANQTHFSLAIDGLALDLQVLSFSGREAISQPFAFDLELVGERPVPDLESLLHKPAFLTLGPAGNGI
HGLVRSAGQGDSGKRLTRYRITLVPQLAYLAQRTNQRIFQHLTVPQIVGRVLEEHGILADAYRFQLGTRY
PEREYCVQYDESDLQFVQRLCCEEGIHFHFQHSATAHLLVFGDDQTVFPRLAPVAYQQDSGLVADRPAVK
RFGVRLETRTSRVTRRDYDFEKPRLTLESAARGEARPDLEDYDYPGRFVDRERGKHLARRALERQRSDYR
LAEGRSDQPLLLSGHFLPLAAHPQAGWNDLWLLTEVIHEGRQPQVLEESIVSDTSASPDDFRQGYRNRFQ
ATPWEAFFRPPLTPPKPRILGTQSAVVTGPKGEEIHCDRYGRVKVQFHWDREGQADDSSSCWLRVASGWA
GRNYGAIAIPRVGMEVLVTFLAGHPDQPLVTGCLFHREHPVPYELPAHKTRSVFKSLSSPGGGGYNELRI
EDRKGQEQIFVHAQRDWDENIQHDQKIRVGHQRHDTVEANSYSEFKAEEHRTTHAERKVEVRASDHLTVA
NDQHLKIASGQFVEAGQEIHLSSGLKVVLEAGAELTLKGGGSFLKLDASGVTLSGANVRVNSGGSPGNGS
GAAPLLPGPLRQADSDKAGALLTPAQINTLKRNAPFCEECEKCKDGACDL
 
Nucleotide Sequence: 2043 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3832600-3834642 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTTCGCAGCAGCCAACCAGACCCACTTCAGCCTCGCCATCGACGGCCTCGCCCTCGACCTGCAGGTGC
TCTCCTTCAGCGGCCGCGAAGCCATCAGCCAGCCGTTCGCCTTCGACCTGGAGCTGGTCGGCGAACGCCC
CGTGCCGGACCTCGAAAGCCTGCTGCACAAACCCGCCTTCCTTACCCTCGGGCCCGCCGGCAACGGTATC
CACGGCCTGGTGCGCAGCGCCGGACAGGGCGACTCGGGCAAGCGCCTGACCCGCTACCGCATCACCCTCG
TCCCGCAACTGGCCTACCTCGCCCAGCGCACCAACCAGCGCATCTTCCAGCACCTCACGGTGCCGCAGAT
CGTCGGCCGGGTGCTGGAGGAACACGGCATCCTCGCCGACGCCTACCGCTTCCAGCTCGGCACCCGCTAC
CCCGAGCGCGAATACTGCGTGCAGTACGACGAGAGCGACCTGCAGTTCGTCCAGCGCCTGTGCTGCGAGG
AGGGCATCCACTTTCATTTCCAGCACAGCGCCACGGCGCACCTGCTGGTATTCGGCGACGACCAGACGGT
GTTCCCGCGGCTCGCGCCGGTGGCCTACCAGCAGGACTCCGGCCTGGTCGCCGACCGGCCGGCGGTCAAG
CGCTTCGGCGTACGCCTGGAAACCCGCACCAGCCGCGTCACCCGCCGCGACTACGACTTCGAGAAACCGC
GCCTGACGCTGGAAAGCGCCGCCCGCGGCGAAGCCCGGCCGGACCTCGAGGACTACGACTATCCCGGTCG
CTTCGTCGACCGCGAGCGCGGCAAGCACCTGGCCAGGCGTGCCCTCGAACGGCAGCGCAGCGACTACCGC
CTGGCCGAGGGCCGCAGCGACCAACCGTTGCTGCTCAGCGGCCACTTCCTGCCGCTGGCCGCCCATCCCC
AGGCGGGCTGGAACGACCTCTGGCTGCTCACCGAGGTGATTCACGAGGGGCGGCAGCCGCAGGTGCTGGA
AGAAAGCATCGTCTCCGACACCTCGGCGAGCCCGGACGACTTCCGGCAGGGTTACCGCAACCGCTTCCAG
GCCACGCCCTGGGAGGCGTTCTTCCGTCCCCCGCTGACACCGCCGAAGCCGCGCATCCTCGGCACGCAGA
GCGCGGTGGTGACCGGTCCGAAGGGCGAGGAAATCCACTGCGACCGCTACGGTCGGGTGAAGGTGCAATT
CCACTGGGATCGCGAGGGCCAGGCCGACGACAGCAGCAGTTGCTGGTTACGCGTTGCCTCCGGCTGGGCG
GGAAGGAACTACGGCGCCATCGCCATCCCGCGGGTCGGCATGGAGGTGCTGGTGACCTTCCTCGCAGGCC
ACCCCGACCAGCCGCTGGTCACCGGCTGCCTGTTCCACAGGGAACATCCGGTGCCCTACGAACTGCCGGC
GCACAAGACCCGCAGCGTCTTCAAGAGCCTCAGCAGCCCTGGCGGCGGTGGCTACAACGAGCTGCGCATC
GAGGACCGCAAGGGCCAGGAGCAGATCTTCGTCCATGCCCAGCGCGACTGGGACGAAAACATCCAGCACG
ACCAGAAGATCCGCGTCGGTCACCAACGCCACGACACCGTGGAGGCGAACAGCTACAGCGAGTTCAAGGC
CGAGGAACACCGCACCACCCACGCCGAGCGCAAGGTGGAGGTCCGCGCCAGCGACCACCTCACCGTAGCC
AACGACCAGCACCTGAAGATCGCCAGCGGCCAGTTCGTCGAGGCCGGCCAGGAGATCCACCTGAGCAGCG
GTCTGAAGGTGGTGCTGGAGGCCGGCGCCGAACTGACCCTCAAGGGCGGCGGCAGCTTCCTCAAGCTCGA
CGCCAGCGGCGTGACCCTCTCCGGGGCCAACGTCCGGGTCAACTCCGGCGGCAGCCCGGGCAACGGCAGC
GGCGCGGCGCCGCTGTTGCCGGGGCCGCTGCGGCAGGCCGACAGCGACAAGGCCGGCGCCCTCCTCACCC
CGGCCCAGATCAATACCCTGAAGCGCAACGCGCCCTTCTGCGAAGAGTGCGAGAAGTGCAAGGACGGTGC
CTGTGACCTCTGA