SecReT6
Protein ID: 116049606
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_43040
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3829090..3829596 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ02KE7
KEGG IDpau:PA14_43040
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-53, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|116049606|ref|YP_791589.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTQRGDERKVEDRKPIGIDKMTFDEVLAKQE
LGLTLSVPNRLQEEGGSDELAVGLQINSMKDFNPASIVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLADDESRSRVLGELGLSAAPSQDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3829596-3829090 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCAAAGGAACGCATCAACGTCACTTTCAAGCCCGCCACCGGCGGCG
CCCAGGAAGAAATCGAACTGCCGTTGAAGCTACTGGCGATCGGCGATTACACCCAGCGCGGGGATGAGCG
CAAGGTGGAGGACCGCAAGCCGATCGGCATCGACAAGATGACCTTCGACGAGGTCCTGGCCAAGCAGGAG
CTGGGGCTGACGCTGAGCGTACCCAATCGTCTCCAGGAGGAGGGCGGCAGCGACGAGCTGGCGGTGGGGC
TGCAGATCAACTCGATGAAGGACTTCAACCCGGCCAGCATCGTCGAGCAGGTGCCCGAGCTGAAGAAGCT
GATGGAGTTGCGCGATGCGCTGGTGGCCCTCAAGGGCCCGCTGGGCAACGCCCCGGCGTTCCGCAAGGCC
ATCGAAAGCGTACTCGCCGACGACGAGTCCCGTAGCCGTGTGCTGGGCGAGCTGGGGCTGAGCGCCGCCC
CCTCCCAGGACGCCTGA