SecReT6
Protein ID: 116049607
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_43030
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3827587..3829062 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ02KE8
KEGG IDpau:PA14_43030
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|116049607|ref|YP_791588.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVKKAMVDRMIAE
IDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSKQDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMAHAPFVAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDSRYVALTVPRFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAF
GTKLTDSFAKYRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3829062-3827587 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGCACCAGTGCCGCACAGCAAGGCCGGAACCAGAACGGCGAATACAACATTCTCGACAGCATCATCG
CCGAGACCCGCCTGAGCCCGGACGACGAGGCCTACGACATCGCCAAGCGCGGCGTCTCCGCCTTCATCGA
GGAATTGCTCAAGCCGCAGAACGACGGCGAGCCGGTGAAGAAGGCGATGGTCGACCGGATGATCGCCGAG
ATCGATGCCAAGCTCAGCACGCAGATGGACGAGATCCTCCATCATCCCGATTTCCAGGCGCTGGAGTCGG
CCTGGCGCGGCCTGCAACTGCTGGTCGACCGCACCAACTTCCGCGAGAACATCAAGATCGAGATTCTCAG
CGTTTCCAAGCAGGACCTGCTGGACGATTTCGAGGACTCGCCCGAGGTGATGCAGTCCGGCCTGTACAAG
CACATCTACACCGCCGAATACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCATCATCGCCAACTACTACA
TGTCGCCCAGTTCGCCCGACGTCAAGCTGATGCAATACGTCTCCAGCGTGGCCTGCATGGCCCATGCGCC
GTTCGTGGCGGCCGCCGGTCCGAAGTTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGAC
CTGAAGGATCATTTCGAAGGCCCGCAGTTCGCCAAGTGGCAGAGCTTCCGCCAGTCCGAGGATTCCCGCT
ACGTGGCGCTGACCGTACCGCGCTTCCTGCTGCGCACGCCCTACGATCCGGAAGAGAATCCGGTCAAGTC
GTTCGCCTACAAGGAGACCGTGGCCAATAGCCATGAGCATTACCTGTGGGGCAACACCGCCTATGCCTTC
GGCACCAAGCTGACCGACAGCTTCGCCAAGTATCGCTGGTGCCCGAACATCATCGGGCCGCAGAGCGGCG
GTGCGGTGGAGGACCTGCCTTTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCCACCGA
GGTGCTGGTGTCCGATCGCCGCGAGTACGAACTGGCCGAGGAAGGCTTCATTTCCCTGACCATGCGCAAG
GGCAGCGACAACGCCGCGTTCTTCTCCGCCAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCCG
AAGGCAAGGCCGCGGAGCTGAACTACAAGCTCGGCACCCAGTTGCCGTACATGATGATCGTCAACCGCCT
GGCCCATTACCTGAAGGTCCTGCAACGCGAACAGCTGGGGTCGTGGAAGGAGCGTACCGACCTCGAGCTG
GAGCTGAACAAGTGGATCCGCCAGTACGTCGCCGACCAGGAAAACCCCAGCGCCGAAGTGCGCGGCCGTC
GCCCGCTGCGCGCTGCACAGATCATCGTCAGTGACGTCGAGGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAACGTGCGCCCGCACTTCAAGTACATGGGGGCGGACTTCACCCTGTCGCTGGTCGGCAAGCTGGACAAA
GAGTAA