SecReT6
Protein ID: 116049608
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_43020
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3827167..3827574 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ02KE9
KEGG IDpau:PA14_43020
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 24..114
Protein Sequence: 135 a.a.     [Download]
>gi|116049608|ref|YP_791587.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MTGYGSLFERLNGDADKRVGWSREVSAMASVAAHLGKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARSAIEGFIEAYEPRLSNVRVVSLPRDNDQLRLAFSIEGLLEVEGFKRQVSFSACLDGSGQVKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3827574-3827167 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACCGGATACGGCAGCCTGTTCGAGCGCCTGAACGGCGACGCGGATAAGCGCGTCGGCTGGAGCCGCG
AGGTTTCCGCCATGGCGTCGGTGGCTGCCCATCTGGGCAAGATGCTCAGCACCCGGGCGGGCAGCGTGCA
GACGCTGTCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACTCCCTGAGCCAG
GCCCGCTCGGCCATCGAAGGTTTCATCGAGGCTTACGAACCGCGCTTGAGCAACGTGCGTGTCGTTTCCC
TGCCGCGCGACAACGACCAGCTCCGCCTGGCCTTCAGCATCGAAGGGTTGCTGGAGGTGGAAGGTTTCAA
GCGCCAGGTGAGTTTTTCCGCATGCCTGGATGGCAGCGGCCAGGTGAAGGTCAGCTAA