SecReT6
Protein ID: 116049609
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_43000
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3825042..3826622 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ02KF0
KEGG IDpau:PA14_43000
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-148, Aligned region: 1..526
Protein Sequence: 526 a.a.     [Download]
>gi|116049609|ref|YP_791586.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MMHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRFRTCYATEVLPLVLEALNYS
VTGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQMLYLCLLRNLESIQLIPLDAHGRPLDGVAG
KPMSFRLTGERVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVR
GLELRFDIRKSGIQRLHPTLENVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGV
TGWRPGGLGYQAYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTC
TNQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLANVDALKVIL
ETYDLPRYYDQHAAKVSKRLLGGLKAVRHEHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNE
FFALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
 
Nucleotide Sequence: 1581 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3826622-3825042 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGATGCACCTGCTGTGGCCGAACTATATGCGCCCGCTGCCGGCTTTCAGCATTCTCCAGTTCGACCCCC
TGACCCGCCCGGGCGGGGCGCTGCGCGTGGAGCGCGATACGCCGGTCGAGAGCCGGCCGGTGGGCGAGGT
CGCCTGTCGCTTCCGTACCTGCTACGCCACCGAAGTCCTGCCGCTGGTGCTGGAGGCGCTCAACTATTCG
GTGACCGGCGAGGGTGCGCTGCTCGGCCTGCGCCTGGCGATGAACTGCGACGGGCATCTCGGCGAGCTGG
GCCTGAGTCGGCTGCGCCTGCACCTGGCCGGCGAGCGCTACATCAGCCAGATGCTCTATCTGTGCCTGCT
GCGCAACCTGGAGAGCATCCAACTGATTCCGCTGGACGCCCATGGGCGGCCGCTGGATGGCGTGGCCGGC
AAGCCGATGTCGTTCCGCCTGACGGGCGAGCGGGTGCAGCCGGTGGGGTTCGCCGAAGACGAGGCGTTGA
TTCCCTATCCGCTGAATACCTTCCGTGGCTATCGCTACCTGCAGGAATACTTCGCGTTCCAGGACAAGTT
CCTGTTCGTCGACGTGGATGGCCTTGACCTGCTCGGCGCTCTGCCCGAGGAAACCCTCAAGCAGGTCCGC
GGCCTCGAGTTGCGCTTCGATATCCGCAAGAGCGGCATCCAGCGCCTGCACCCGACGCTGGAGAACGTCA
AGCTGTACTGTACGCCGGTGGCCAACCTGTTCCGCCACGATGCGCTGCCGATCCGCCTAGACGGCAAGCA
GGACGAATACCTGCTGATGCCGGCCGAATACAGCCTGGAGGACTGCGGGGTGTTCTCGGTAGAGGGCGTC
ACCGGCTGGCGGCCGGGCGGGCTCGGCTACCAGGCCTACGTGCCGTTCGAGTCCTTCGAGCACGATCCCA
GCTTCGACGTTCCCGAAGCACGGCCCCACTACAGCGTCCGGCAACGTACCTCGTTGCTGCACGATGGCCT
GGACACCTACCTGAGCTTCGGCATCCGCCATCCCGAGCAGATCGAGACGCTGTCGGTGGAACTGACCTGC
ACCAACCAGAACCTGCCCCAACGGCTGCGCCTGGGCGATATCTGCGTCGCCTGCGAAGGCACGCCGGAGT
TCCTCGGTTTCCGCAATATCACCCCGGCGACGCCGAGCTACGCGCCGCCGCTGAACCGCGATTTCCTCTG
GAAACTGATCAGCAACATGTCGCTCAACTACCTGTCGCTGGCCAACGTCGACGCGCTCAAGGTGATCCTC
GAAACCTACGACCTGCCGCGCTACTACGACCAGCATGCGGCGAAGGTCAGCAAGCGCCTGCTGGGCGGGC
TCAAGGCGGTCCGCCACGAGCATGTCGACCGCCTGCATCGGGGCCTGCCGCTGCGCGGCTTGCGTACCGA
GCTGACGATCGATCCGGAAGGCTACATCGGCGAGGGCGACCTGTTCGTGTTCGCTTCGGTTCTGAACGAA
TTTTTCGCGCTTTACGCCAGCATCAACTCCTACCACGAGTTGCGGGTGAGGAGCACACAGGGAGACGTGT
ACCAATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAA