SecReT6
Protein ID: 116049610
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_42990
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3824071..3825078 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ02KF1
KEGG IDpau:PA14_42990
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-89, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|116049610|ref|YP_791585.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
METAHGFAAPAVSALARGIREYSLFQAVLLVMDRLREEHPGLGDEALYDQLEFQANPSLGFPGSDVDRVE
FFEERGMLRARLRFNLIGLFGASSPLPAFYSEQALGDSEEGNPTRNFLDLFHHRLHRLLLPIWRKYRYRV
SFQSGASDAFSAQLFALVGLGGEEIRKARELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELVAEQ
CIERRVAILEEQRNRLGLFNSQLGEDAVLGERVRDRSGKFRIHIRQLDWQRFHEFLPIGPGYQPLCALVR
FTLRDPLDYDIRLVLRQEEIREFRIGAQNACRLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3825078-3824071 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGAAACCGCGCATGGGTTTGCAGCCCCTGCTGTAAGCGCGCTGGCCCGGGGCATTCGCGAGTACTCGC
TGTTCCAGGCGGTCCTGCTGGTCATGGATCGCCTGCGCGAGGAACATCCCGGCCTGGGAGACGAAGCGCT
CTACGATCAGTTGGAATTCCAGGCCAATCCTAGCCTCGGCTTCCCGGGCAGCGATGTCGATCGGGTGGAG
TTCTTCGAAGAGCGCGGCATGCTGCGGGCGCGGCTGCGTTTCAACCTGATCGGCTTGTTCGGTGCCAGTT
CGCCGTTGCCGGCGTTCTACAGCGAGCAGGCCCTGGGCGACAGCGAGGAGGGCAATCCTACGCGGAACTT
CCTCGATCTCTTCCATCACCGCCTGCATCGGCTGCTATTGCCGATCTGGCGCAAGTACCGCTACCGGGTG
AGCTTCCAGAGCGGCGCGAGCGATGCGTTCTCCGCTCAGTTGTTCGCCCTCGTCGGATTGGGCGGGGAAG
AGATCCGCAAGGCCAGGGAACTGAACTGGAAACGTCTGCTGCCCTACCTGGGCCTGCTCAGCCTGCGGGC
GCACTCGGCGGCCTTGATCGAGTCGGTGCTGCGCTACTACTTCAAGCATGCCGAACTGGTCGCCGAGCAG
TGTATAGAACGGCGCGTCGCGATCCTCGAAGAGCAGCGCAACCGACTCGGCCTGTTCAACAGCCAGCTTG
GCGAAGACGCGGTGCTGGGCGAACGGGTCCGCGACCGCAGCGGCAAGTTCCGCATTCATATCCGCCAGCT
CGACTGGCAGCGCTTCCACGAGTTCCTGCCGATCGGTCCCGGCTACCAGCCGCTTTGCGCGCTGGTCCGC
TTCACCCTGCGCGACCCGCTCGACTACGACATCCGGCTGGTCTTGCGCCAGGAGGAAATCCGCGAGTTCC
GCATCGGCGCTCAGAACGCCTGCCGCCTTGGCTGGACCAGTTGGCTGGGCCGGGAGCGCGCCGATGGCGT
GGTGACGCTGGGCAGCAAGATTCATTAA