SecReT6
Protein ID: 116049615
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_42940
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3817957..3818463 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ02KF6
KEGG IDpau:PA14_42940
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|116049615|ref|YP_791580.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLGRKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3818463-3817957 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTCTCGTCGCCCGATTCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAGCACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCG
AGGAGCTGGAGCTGCGGCCCGGCGAGCGGGTCGAACTCAAACTCAGCGTGGAGGAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGGCCGGAAGGGCATCCTGAATGCCGGCGAACTGCTCGGCAAGG
CGGGTGACGCGCGATGA