SecReT6
Protein ID: 116049617
SecReT6 ID152
T6SS typei1
Gene symbol-
Locus tagPA14_42910
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3815757..3816626 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ02KF8
KEGG IDpau:PA14_42910
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-69, Aligned region: 61..266
Protein Sequence: 289 a.a.     [Download]
>gi|116049617|ref|YP_791578.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSLNPLVAAASEL
LSEVVRLKHSSVLENLAALKERLTSAMKLFEFRAVQDGVENSQVMAARYVLCTVVDEAVVTTPWGNESEW
SKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLALGFEGKYRVMARGVLDLDGISDALY
RQIRQLRGDVPRELSPHWQGLSDQRRGLVRIVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSL
DAAAGQPGS
 
Nucleotide Sequence: 870 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c3816626-3815757 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGATCAAGGAAAGGGAATACCACGAGGACGAGAAGACCGTCCTCCTCGATCACCAGGGACAGGTACCGG
CCCAGGGGCCGCTGACCGATTTCGCCGAACCGCCGCGCTTCGAGCAGCTCGAGGAGCGGATGATCTACGC
GGCGCGCCTGCGTCCGGGCGAGGCCTTCAACGTCAGCCTGAACCCGCTGGTGGCGGCGGCTTCCGAACTG
CTTTCGGAAGTGGTCCGGCTCAAGCACAGCAGCGTGCTGGAGAACCTTGCGGCGCTCAAGGAGCGGTTGA
CCTCCGCCATGAAGCTCTTCGAATTCCGCGCCGTGCAGGATGGCGTGGAAAACAGCCAGGTCATGGCGGC
GCGCTACGTGCTGTGCACGGTGGTCGACGAGGCGGTGGTGACCACCCCGTGGGGCAACGAAAGCGAATGG
TCGAAGATCAGCCTGCTGAGCAGCTTCCATAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGTTGCTCG
ACCGGCTGTCGAAGAACCCGGTCAAGCATCTGCCGATGCTGGAGCTGATGTACCTCTGCCTGGCCCTCGG
CTTCGAGGGCAAGTACCGGGTGATGGCTCGCGGCGTGCTCGACCTGGACGGTATTTCCGATGCGCTCTAC
CGGCAGATCCGCCAGTTGCGCGGCGACGTGCCGCGCGAACTGTCGCCGCACTGGCAGGGGCTCAGCGACC
AGCGTCGCGGCCTGGTGCGGATCGTGCCCTGGTGGATGGTGGCGCTGTTCACCCTGGTCTGCCTGGTGGT
GATGTATTCGGGATTCGCCTGGGTTCTCGGCGAGCAACGCGACACGGTGCTGCAGCCTTACCAGTCGCTC
GATGCGGCGGCAGGACAGCCCGGTTCGTAA