SecReT6
Protein ID: 116053791
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00820
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]80049..80963 [-]
Producthypothetical protein
NoteTagQ
UniProt IDQ02V10
KEGG IDpau:PA14_00820
PDB IDNA
Domain hit(s) vs Pfam Gly-zipper_Omp [PF13488], Evalue: 1.10E-07, Aligned region: 71..117
Gly-zipper_OmpA [PF13436], Evalue: 7.30E-06, Aligned region: 59..123
Gly-zipper_OmpA [PF13436], Evalue: 7.30E-06, Aligned region: 257..274
Rick_17kDa_Anti [PF05433], Evalue: 1.10E-05, Aligned region: 70..113
Gly-zipper_YMGG [PF13441], Evalue: 7.80E-05, Aligned region: 67..112
Protein Sequence: 304 a.a.     [Download]
>gi|116053791|ref|YP_788226.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAEYYPSCYEPVSHLRSTDNAVRNSAIT
GAITGGLLGGLAGGLASDENRGRNAALAAAGGALAGGAAGYYMEKQKQISDDRARIGSYATDVDRSTVEI
NRSVAYAKSAQSCYQSQFKALLDGRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENINNYTQA
YEKDLQQVGVPRTEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASRG
QGMIQEVCNSPDMGDWAPPSCAKA
 
Nucleotide Sequence: 915 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c80963-80049 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGCCAACCCAGCGAAAACCGTTTGATCACCTCGGCGCGCTACGCGCTCTGCCTGTTGACCGCCAGCG
GCGTGCTGCTCAGCGGCTGCGCCAGCAGCGGCGTCGGCTCGGTCGCCCAGACCACCCGCGCGGAATACTA
CCCGTCCTGCTACGAGCCGGTGTCGCACCTGCGCAGCACCGATAACGCGGTGCGCAACTCGGCCATCACC
GGCGCCATCACCGGCGGCCTCCTGGGCGGCCTGGCCGGCGGCCTGGCCAGCGACGAGAACCGCGGCCGCA
ATGCCGCCCTCGCTGCCGCAGGCGGCGCCCTGGCCGGCGGCGCGGCGGGCTACTACATGGAGAAGCAGAA
GCAGATCAGCGACGACCGCGCGCGCATCGGCTCCTACGCTACCGACGTCGACCGCAGCACCGTCGAGATC
AACCGTAGCGTGGCCTACGCCAAGTCGGCGCAAAGCTGCTACCAGAGCCAGTTCAAGGCCCTGCTCGACG
GCCGCAAGAACAAGTCGATCAACGAAGCCGAAGGGCGCAAGCGCCTGGCCGAGATCGTCAGCGGCCTGCA
GGAGACCAACGCCCTGCTGGTCGCCGCCAACGGCCGTGCCGGCGAGAACATCAACAACTACACCCAGGCC
TACGAGAAAGACCTGCAGCAGGTCGGCGTACCGCGCACCGAAGTGACCAAGGTCGCCGAGGCCGAGAACC
GCGCCAGCACTACGAAAGGCGGCAGCAAGCCCAAGACCGGCAGCAATCCCAAGGTGCCGAAGGAGGCGGT
CGCCACCGAGCAGACCATCCGCAAGGCCCAGGACGCGCAAAGCGAAGGCAACAAGGTGGCCTCCCGGGGC
CAGGGCATGATCCAGGAAGTCTGCAACAGCCCGGACATGGGCGACTGGGCACCGCCGAGCTGCGCCAAGG
CCTGA