SecReT6
Protein ID: 116053792
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00830
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]81025..82737 [-]
Producthypothetical protein
NoteTagR
UniProt IDQ02V09
KEGG IDpau:PA14_00830
PDB IDNA
Domain hit(s) vs Pfam FGE-sulfatase [PF03781], Evalue: 1.60E-29, Aligned region: 127..359
Protein Sequence: 570 a.a.     [Download]
>gi|116053792|ref|YP_788227.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MFEKAILPLALGACLAFAAPAWAEGDSPDNPKPLADDVALPLPCGGEMVFRHVYVLAEGALDDREVNLGY
AFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPAWQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYA
AVMSQAAALSGQGEAPACDVPGGMAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGG
IGFVRLPTEVEWEFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLPVGMK
RPNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYPLFAADGSEQR
NETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQLDGIIAATRDPQMQAQLAQIN
EELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIRLTNLKKDREKAVAARDQATAQLYAGAIANGRS
ALDGALAIYIDNLATGTRYTDAVIQAQFQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAV
LKELLASSGR
 
Nucleotide Sequence: 1713 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c82737-81025 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTTTGAGAAAGCCATTCTTCCGCTCGCCCTCGGCGCCTGCCTGGCATTTGCCGCGCCGGCCTGGGCCG
AAGGCGACTCGCCGGACAATCCCAAGCCGCTGGCCGACGACGTCGCCCTGCCGCTGCCGTGTGGCGGCGA
GATGGTCTTCCGGCATGTCTACGTACTCGCCGAAGGCGCCCTCGACGATCGCGAGGTCAACCTCGGCTAC
GCCTTCAACGAAGGCGAGGCGGGCTACCAGCAGTCGTTCATCTCCGGCTACCGGCGCGACTACGTGAACG
GCCAGTTCAGCCTCGCCGACCTGGCACCGGCCTGGCAGCAGAAGCTCTCCGCCAGCCTGCCGAAGCCCGC
CGCCGGCACCCCGCTGAAGCCGATGCTGTACTTCATCGGCAAGTACGAGGTGACCGCCCGCCAGTACGCC
GCAGTGATGAGCCAGGCGGCCGCGCTCTCCGGCCAGGGCGAAGCGCCGGCCTGCGACGTGCCGGGCGGGA
TGGCCGCGCGGCTGCCCAAGGTCGACCTCTCGCGCTTCGACGCCGAACGCTTCGGCGCGGTGTACAGCGC
CTGGCTGCTGAAGAACCACCCGGATCTGCTGCCGGTCAGCGGCCGCGGCAAGAATCCCGAGGACGGCGGC
ATCGGCTTCGTCCGCCTGCCCACCGAGGTCGAGTGGGAGTTCGCCGCGCGCGGCGGCCAGGCGGTCAGCC
GCCAGGAACTGGAAGGCCGGCTGTTCCCGCGCAAGGTCGAGGGCAGCGACCAGGAAGGCCCGCTGGGCGA
CTGGGCGGTGTACAACCAGGTCGCCGGCGGTACCGGCCAGGCCGCGCGACTGTTGCCGGTAGGGATGAAG
CGGCCGAACCCGCTGGGCCTGTTCGACGTGATCGGCAATGCCGCGGAGATGGTCCAGGAGTCCTTCCAAC
TGGTCCACGCCGGTCGCCGGCAGGGCACATATGGCGGTTTCGTGGTGAAGGGCGGGAACTATCTCGAAGG
CGAGATGACTCTATTCACCGGGATGCGCCGCGAATACCCGCTGTTCGCCGCCGACGGCAGCGAACAGCGC
AACGAGACCACCGGTTTCCGCGTCGCCATCGGCGCGCTGTCCGCGCCGCGCTCGCGCTATCCCGAGCTGT
TCGCCCAATGGCAGAAGGAAGGCCGACTAGCGGCATTGACCGATGCCATCGATGACGCTCAAGATCCCAC
CAAGCAATTGGACGGAATCATTGCCGCCACCCGCGACCCGCAGATGCAGGCGCAGTTGGCCCAGATAAAC
GAGGAACTCAAGCGTAACGTTTCGTTGATCGCTCGGCAGCGCGAAGAGGCCGCCGGAAACCTGATACAGT
CGGCGGCACTGGTCGCCGAGACGATCAACAACTACAACATACGCCTGACCAACCTCAAGAAGGACAGGGA
GAAAGCCGTGGCAGCCAGGGATCAGGCGACCGCCCAGCTCTATGCCGGCGCCATCGCCAACGGGCGCAGC
GCCCTCGATGGCGCATTGGCCATCTACATCGACAACCTCGCCACCGGCACCCGTTACACCGACGCGGTGA
TCCAGGCGCAGTTCCAGCGCATCCAGGAAGAACTCAATCGCAACCCGGTTCTGGGCAAGAGCCTGGTCAA
GCGCGCGACCCTGTTCGTCAAACACGTCGGAGATTATCGCCAGCAGCACCGGGCCGAGCCGGAGGCGGTA
TTGAAGGAATTGCTCGCGTCCAGCGGGCGTTGA