SecReT6
Protein ID: 116053793
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00850
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]82730..83929 [-]
Producthypothetical protein
NoteTagS
UniProt IDQ02V08
KEGG IDpau:PA14_00850
PDB IDNA
Domain hit(s) vs Pfam FtsX [PF02687], Evalue: 2.70E-09, Aligned region: 23..50
FtsX [PF02687], Evalue: 2.70E-09, Aligned region: 274..391
Protein Sequence: 399 a.a.     [Download]
>gi|116053793|ref|YP_788228.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MRAGLLLSLAWADYRGEARLSLCAIFALAAVITPLLVLFGLKYGLVSTLTERLERAPSVREIIPVGGARY
RAEDIAALAARADVAFAVPRTRQIAATADLSGGGETALSVEMIPSAAGDPLLAGLPQPDRPTRVVLSHGA
AEKLGAQPGERIVARIGRRMDGQAQSQRLELEVLAVLPQERFARDALFAPLALLEAAEDYRDGRAVAAYG
WPGKAGETPRARIYPGFRLYARDLDAVEGLRRHFVASGVEVATQAEAIAQVRSLSRNLGLVFWIVAALAI
GGAFAAIAASSLAAVERKRRALAVLRLLGFPTAALVGFVMFLALFSAVFGLFLAGLLYAATAGALNHLFD
NQSGEFVCRLLPSHYLTALLATLLCSVLAAASGGWRAARIEAAEGLRDV
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c83929-82730 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCGCGCCGGCCTGCTGCTCTCGCTGGCCTGGGCCGACTATCGCGGCGAGGCGCGCCTGTCGCTCTGCG
CGATCTTCGCCCTGGCGGCGGTGATCACCCCGCTGCTGGTGCTGTTCGGCCTCAAGTACGGCCTGGTCAG
CACCCTCACCGAGCGGCTGGAGCGCGCGCCTTCGGTGCGCGAGATCATTCCGGTCGGCGGCGCCCGCTAC
CGTGCCGAGGACATCGCCGCCCTGGCCGCACGCGCGGATGTCGCCTTCGCCGTGCCGCGCACCCGGCAGA
TCGCCGCCACCGCCGACCTCAGCGGCGGCGGCGAGACCGCCCTGAGCGTCGAGATGATTCCCAGCGCCGC
CGGCGACCCGCTGCTGGCCGGCCTGCCGCAACCCGACCGGCCGACCCGCGTGGTGCTCAGCCACGGCGCC
GCGGAAAAACTCGGCGCCCAGCCTGGCGAGCGCATCGTCGCGCGCATCGGCCGGCGCATGGATGGCCAGG
CACAGAGCCAGCGCCTGGAGCTGGAAGTGCTCGCGGTGCTGCCGCAGGAGCGTTTCGCCCGCGACGCGCT
GTTCGCCCCGCTAGCCCTGCTGGAAGCCGCCGAGGACTATCGCGACGGTCGCGCGGTGGCCGCCTACGGC
TGGCCGGGGAAGGCCGGCGAGACCCCGCGCGCACGCATCTACCCGGGCTTCCGCCTGTACGCCCGAGACC
TCGATGCGGTGGAAGGGCTGCGCCGGCACTTCGTCGCGAGTGGCGTGGAAGTCGCCACCCAGGCCGAGGC
CATCGCCCAGGTGCGCAGCCTCAGCCGCAACCTCGGCCTGGTGTTCTGGATCGTCGCCGCGCTGGCCATC
GGCGGTGCCTTCGCGGCCATCGCCGCCAGCAGCCTGGCCGCCGTCGAACGCAAGCGCCGCGCCCTGGCGG
TGCTGCGTCTGCTGGGCTTCCCGACCGCCGCGCTGGTCGGCTTCGTCATGTTCCTGGCGCTGTTCAGCGC
CGTCTTCGGCCTGTTCCTCGCCGGGCTGCTGTACGCCGCCACGGCCGGCGCGCTGAACCACCTGTTCGAC
AACCAGAGCGGCGAGTTCGTCTGCCGCCTGCTGCCCAGCCACTACCTGACGGCGCTGCTCGCCACGCTGC
TGTGCAGCGTCCTGGCCGCCGCCAGCGGCGGCTGGCGCGCGGCGCGGATCGAAGCCGCAGAGGGATTACG
CGATGTTTGA