SecReT6
Protein ID: 116053794
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00860
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]83929..84648 [-]
ProductABC transporter ATP-binding protein
NoteTagT
UniProt IDQ02V07
KEGG IDpau:PA14_00860
PDB IDNA
Domain hit(s) vs Pfam ABC_tran [PF00005], Evalue: 6.20E-25, Aligned region: 26..176
AAA_21 [PF13304], Evalue: 3.70E-14, Aligned region: 35..56
AAA_21 [PF13304], Evalue: 3.70E-14, Aligned region: 134..209
SMC_N [PF02463], Evalue: 7.10E-06, Aligned region: 34..54
SMC_N [PF02463], Evalue: 7.10E-06, Aligned region: 146..214
AAA_29 [PF13555], Evalue: 8.30E-06, Aligned region: 30..62
AAA_10 [PF12846], Evalue: 2.70E-05, Aligned region: 34..55
AAA_10 [PF12846], Evalue: 2.70E-05, Aligned region: 147..207
AAA_17 [PF13207], Evalue: 8.60E-05, Aligned region: 35..100
AAA_17 [PF13207], Evalue: 8.60E-05, Aligned region: 170..200
AAA_16 [PF13191], Evalue: 0.0001, Aligned region: 31..113
AAA_25 [PF13481], Evalue: 0.00037, Aligned region: 30..81
AAA_22 [PF13401], Evalue: 0.00084, Aligned region: 34..55
AAA_23 [PF13476], Evalue: 0.00086, Aligned region: 35..58
Rad17 [PF03215], Evalue: 0.0015, Aligned region: 24..55
NACHT [PF05729], Evalue: 0.0015, Aligned region: 32..57
NACHT [PF05729], Evalue: 0.0015, Aligned region: 179..200
DUF258 [PF03193], Evalue: 0.0025, Aligned region: 31..53
Protein Sequence: 239 a.a.     [Download]
>gi|116053794|ref|YP_788229.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MILRLHEVARSHGAGRQRYRLRVPALELRAGRQLAIVGPSGCGKSTLLDLLALALAPDPGGRFEFLAGER
PQDIAALWRDGRQDRLAALRRQHCGYVLQSGGLLEFLDVRRNIGLPCALLGAPSAERVQALAERLEIGDQ
LDKKPAALSVGQRQRVAIARALAHAPRLLLADEPTAALDPLNAERVMRLLVEQARERGACTVVATHDERL
ARAAGLEVLAIRWQREADDSVGACLEDVG
 
Nucleotide Sequence: 720 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c84648-83929 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGATCCTGCGCCTGCACGAGGTCGCCCGCAGCCACGGCGCCGGTCGCCAGCGCTACCGCCTGCGGGTGC
CGGCGCTGGAATTGCGCGCGGGTCGCCAGCTGGCCATCGTCGGCCCCAGCGGCTGCGGCAAGAGCACCCT
GCTCGACCTGCTGGCGCTGGCCCTGGCGCCGGACCCGGGCGGGCGCTTCGAATTCCTCGCCGGGGAACGC
CCGCAGGACATCGCCGCGCTCTGGCGCGACGGCCGCCAGGACCGCTTGGCGGCGCTGCGCCGGCAGCACT
GCGGCTACGTGCTGCAAAGCGGCGGGTTGCTCGAGTTCCTCGATGTGCGGCGCAACATCGGACTGCCCTG
CGCGTTGCTCGGCGCCCCGTCCGCCGAGCGCGTGCAGGCGCTGGCCGAGCGGCTGGAAATCGGCGACCAG
CTGGACAAGAAACCGGCGGCGCTGTCGGTCGGCCAGCGCCAGCGGGTCGCCATCGCCCGCGCCCTGGCGC
ATGCGCCGCGCCTGTTGCTGGCCGACGAGCCGACCGCGGCGCTCGACCCGCTGAACGCCGAACGGGTGAT
GCGCCTGCTGGTGGAACAGGCCCGCGAGCGCGGCGCCTGCACCGTGGTCGCCACCCACGACGAGCGCCTG
GCCCGCGCCGCCGGACTCGAAGTCCTGGCCATCCGCTGGCAACGCGAGGCCGACGACAGCGTCGGCGCCT
GCCTCGAGGACGTTGGCTGA