SecReT6
Protein ID: 116053795
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00890
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]87751..88479 [-]
Productphosphoprotein phosphatase
NotePppA
UniProt IDQ02V05
KEGG IDpau:PA14_00890
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.40E-13, Aligned region: 20..209
PP2C [PF00481], Evalue: 2.70E-11, Aligned region: 29..234
SpoIIE [PF07228], Evalue: 2.10E-07, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|116053795|ref|YP_788231.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MVPNSVSYYRSASYSHVGMVRKVNEDASLDAPESGLWVVADGMGGHAAGDFVSSLIVDTLRRIPAASSLP
AYVGALRTGLAQVNERVRQEAGLRGVSVMGSTLVLLAARGNQASCLWAGDSRLYRLRGGVLEAISRDHSY
VQELLDNALISEEEARHHPRANVVTRAVGVHEQLELSEAALHVLPGDSFLLCSDGLNKTADDSELRDVLS
HSDPYAVVRSLVHLGLTRGAPDNITALVVRAF
 
Nucleotide Sequence: 729 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c88479-87751 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGTGCCCAACTCAGTCAGCTACTACAGGTCGGCCAGCTACAGCCACGTCGGCATGGTCCGCAAGGTCA
ACGAAGACGCCAGTCTCGACGCCCCAGAGTCGGGACTCTGGGTGGTCGCCGACGGCATGGGCGGCCACGC
CGCCGGCGACTTCGTCAGCAGCCTGATCGTCGATACCCTGCGGCGCATCCCGGCGGCCTCCTCGCTACCG
GCCTACGTCGGCGCGTTGCGCACCGGCCTCGCCCAGGTCAACGAGCGGGTTCGCCAGGAGGCCGGCCTGC
GTGGCGTCAGCGTGATGGGCAGCACCCTGGTACTGCTCGCCGCGCGCGGCAACCAGGCGAGCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGCCTGCGCGGCGGCGTGCTGGAAGCCATCTCGCGGGACCACAGCTAC
GTCCAGGAGCTGCTCGACAACGCATTGATCAGCGAGGAAGAGGCGCGCCACCATCCGCGCGCCAACGTGG
TCACCCGCGCGGTCGGCGTGCACGAGCAACTGGAACTGTCGGAAGCCGCGCTGCACGTGCTGCCCGGCGA
CAGCTTCCTGCTCTGCAGCGACGGCCTCAACAAGACCGCCGACGACAGCGAACTGCGCGACGTGCTCAGC
CACAGCGATCCCTATGCGGTGGTCCGCAGCCTGGTCCACCTGGGCCTGACCCGCGGCGCCCCGGACAACA
TCACGGCCCTGGTGGTCAGGGCCTTCTGA