SecReT6
Protein ID: 116053798
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00940
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]94052..95386 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ02V01
KEGG IDpau:PA14_00940
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-158, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|116053798|ref|YP_788235.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGFSELKLDDALLTQGKLAIVSARGVLP
DGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPLKRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFES
RAPVALGSQAFRLLTERDGLGEYAAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLL
HQRGEALAGRVVASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQ
RRPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLIDNASFVLVVR
ADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPYHAGSTYFELDRGSAHWKQLTH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c95386-94052 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTCCTGGAATAACCGCGTGGTGTGGTCCGAAGGCATGTTCCTGCGGCCACAGCATTTCCAGCAGCACG
ACCGCTACCTGGAAACCCTGGTGGATGGCCGCTGCCGCTCGCTCCTGGCGGGCGGCTGGGGCTTTTCCGA
GCTGAAGCTGGACGATGCCCTGCTGACCCAGGGCAAGCTGGCCATCGTCAGCGCCCGCGGCGTGCTGCCG
GATGGCACGCCGTTCAACATCCCCGCCGACGATCCGGCGCCGGCGCCGCTGAATGTCGAGGAAAGCCTGC
GCGATGGCATCGTCTACCTCGGCCTGCCGCTGAAGCGCGTCGGCACCCGCGACACGGTAGAGGAGGGCGA
GGCCCTCGGCGGCGCCCGCTACGTCAGCCAGGTGCAGGAAGTGCGCGACGACAATGCCGCCTTCGAGAGC
CGCGCGCCGGTGGCCCTGGGCAGCCAGGCGTTCCGCCTGCTGACCGAGCGCGACGGCCTCGGCGAATACG
CCGCGGTGGGCGTCGCGCGGGTCCGCGAGAAGCGCGCGGACCAGGCCCTGAGCCTGGACGAGGACTACCT
GCCGCCGGTACTCGACATTGCCGCCGCGCCGCCCCTGGCGTCCTTCGCCAAGGAGCTGCTGGGCCTGCTC
CACCAGCGCGGCGAAGCCCTCGCCGGGCGGGTGGTGGCCTCCAGCGCCGGGGGCGCCTCGGAAATCGCCG
ACTTCCTGCTGCTGCAACTGGTCAACCGCGCCGAGGCCCTCACCGGTCACCTGTCCCGCGTGCGCCCGCT
GCACCCGCAGGAGCTGTACCGCGAACTGGTGGCCCTGGCCGGCGAGTTCTGCACCTTCACCGCCAGCCAG
CGGCGTCCCGAGGAGTACCCGGTGTACAACCACGACGACCTGGCCGCCAGCTTCGCCCCGGTGATGCTCG
CCCTGCGCCAGGCGCTGGCGACGGTGATCGACGCCAAGGCGATCGCCATCCCGATCGTCGAGAAGGCCTA
CGGCGTGCACGTCGCGATGCTCAGCGACCGCAGCCTGATCGACAACGCCAGCTTCGTCCTGGTGGTGCGC
GCCGACGTCCCCGGCGAGAGCCTGCGCGGGCACTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGTATCGGCCTGCTGCCGATGCCGGTGGCGCCGCGGCAGAT
CCCCTACCACGCCGGCTCCACCTATTTCGAACTGGACCGCGGCAGCGCGCATTGGAAGCAGCTGACGCAC
TCCGGCGGCTTCGCCTTCCACATCGCCGGCCAGTTCCCCGGGCTGAACCTGGCCTTCTGGGCCATTCGAG
GATAA