SecReT6
Protein ID: 116053799
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00960
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]95402..95866 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ02V00
KEGG IDpau:PA14_00960
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-43, Aligned region: 11..146
Protein Sequence: 154 a.a.     [Download]
>gi|116053799|ref|YP_788236.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFAL
TDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDIT
LGAQAIGIVARPAP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c95866-95402 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCAGAAACTGATCGTCGCGCTGTTCGGGCTGCTGCTCGCCGCCTGTTCGTCCAGCCCGCCGGAAACCC
CGCCGACCCGGGTGGTGATCTGGCTCCACGCCGCACCGAACCTCAACCCGTCCGCCGCCGGCCAGGCGGC
GCCGCTGCGCCTGCGGCTGTACGAGCTGAAGAAAGACACCGCGTTCGGCCGCGCCGACTACTTCGCCCTC
ACCGACAACGCCCAGTCGACCCTCGGCGGCGACCTGGTGGAGCAGGACGAGTTCCTCCTGCGTCCGGGCG
AGGAACGGCGCATCGAACGCACGCTCGACGAGCAGACCCGCCAGCTCGGCTTCGTCGCCGCCTACCGCGA
CCTCGACCGCGCCACCTGGCGCCAGGTCCTCGACGTGCCGGGGCAACGCACCAGCCATCTCGACATCACG
CTCGGCGCGCAGGCCATCGGCATCGTCGCGCGTCCCGCGCCCTGA