SecReT6
Protein ID: 116053801
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00980
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]96450..97409 [-]
Producthypothetical protein
NoteFha
UniProt IDQ02UZ8, Q02UZ8
KEGG IDpau:PA14_00980
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.10E-16, Aligned region: 29..97
FHA [PF00498], Evalue: 8.10E-16, Aligned region: 29..97
Protein Sequence: 319 a.a.     [Download]
>gi|116053801|ref|YP_788238.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPERLVSSRHCTILNRDGVYYLTDTSTNG
VLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQLGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAF
AEPAPTPHPAVTAHFQGGSPLDTKPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPLPPATTPAPP
PAGGAPLIPADWDPFAELLGNTPAPSATPVVQPQPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQ
PQPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQ
 
Nucleotide Sequence: 960 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c97409-96450 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCGCTGCGATTGACCATCACCAGCTACCACAAGCTGACCCCCGGTCAGTGTTCGGAAAAGGTACTGG
ACCAGGGACAGCTGACCATCGGTCGGGGCCCGGACAACGACTGGGTCCTGCCGGACCCGGAGCGCCTGGT
CTCCAGCCGCCACTGCACCATCCTCAACCGCGACGGGGTGTACTACCTCACCGACACCAGCACCAACGGC
GTGCTGCTGGTCAATGCCGGGCACCGCCTGCGCCGCGGCAACAGCGAGCCGCTGCAGGACGGCGAGACCG
TCCGCCTCGGCGAATACGACATCCTCGTCCAGCTCGGCCACGACATCGCCCTGCCCGGCAGCGGCAATCC
GCAGACCGATCCGTTCACCAGCTTCGACGCACTGATGAGCCGGCAGGCCGCCGGATCGGCGCCTGCCTTC
GCCGAACCGGCGCCCACCCCGCACCCCGCGGTGACGGCGCATTTCCAGGGCGGCTCGCCGCTGGACACCA
AGCCCGACCTGTTCGACTTCCTCACCCCGCCGCCGCCCGGCGCGGCGCCGCGTCCGGACCATGTACCGGC
CGAACAGCACGACTTCCGCCCGCCGGAACCGGTGATCCCGCTGCCCCCCGCGACCACCCCGGCGCCACCG
CCCGCTGGCGGCGCACCGCTGATTCCGGCCGACTGGGACCCGTTCGCCGAACTGCTCGGCAACACGCCCG
CGCCAAGCGCCACGCCCGTCGTCCAGCCGCAGCCAGCGGCCGAACCGACGCCGCTGGCGATGCCCTTCGC
CGACCCGGGGATCACCCAACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAGCCACAG
CCACAGCCACAGCCACAGCCAGCCAGCGTGGCGGCGCCGACGCCCCCGGCAAGCGCCGCCGCGACGGCCG
GCGGCGACCTGCTGCAGGCGTTCCTGCGCGGCGCCGGCATGACCCAGTGA