SecReT6
Protein ID: 116053807
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_01060
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]102506..103015 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ02UZ2
KEGG IDpau:PA14_01060
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-23, Aligned region: 36..145
Protein Sequence: 169 a.a.     [Download]
>gi|116053807|ref|YP_788244.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVLRDLAWLFNTTSLFDHGPAARMPAGN
SVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAE
PAPLRLLLTTNLDLETGHVRVAQGERRRT
 
Nucleotide Sequence: 510 bp     [Download]
>gi|116048575|ref|NC_008463.1|:102506-103015 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCTGAACTGACCCTCCAGGAGCGCCTGCAGCCGTCGCTGCTCGACCGCCTCACCGACGACGAGCCGG
GCAACCTCAAGGAAGCCGCGGAGCGCCGGGTGCTGACCCTGAGCCAGCTGAAGGCCTCGGTGCTGCGCGA
CCTGGCGTGGCTGTTCAACACCACTTCGCTGTTCGACCACGGCCCCGCCGCACGGATGCCGGCCGGCAAC
TCGGTGCTCAACTACGGGCTGCCGGCGCTGGCCGGGCACACCGCGTCGAGCGTCGACGTGCATGCCATCG
AGGCGCTGCTCACCGAGACCATCGCCACCTTCGAGCCGCGCATCATCCGTTCTTCGTTGCGGGTGCGCGC
GCAACTGCTGCCCGGCGAGATGGACCACAACGCCCTGAGCTTCGAGATCGAGGGCGATCTCTGGGCCGAA
CCGGCGCCGCTGCGCCTGCTGCTGACCACCAACCTGGACCTGGAGACCGGTCACGTGCGCGTCGCCCAGG
GCGAGCGGAGGCGTACATGA