SecReT6
Protein ID: 116053808
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_01070
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]103012..104871 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ02UZ1
KEGG IDpau:PA14_01070
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-224, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|116053808|ref|YP_788245.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGALSSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWP
LEVAQADYFGNPAAVLGRLAASEPRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLG
NACAVFVRAPDNAWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRAL
RRCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVIVDRTRPLDFE
VHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSKQRRKGPRSTYVGSETFVALVD
ANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFTLEDSAPVMQVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLAERGQGAAALRELLRLYGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEIT
LDFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|116048575|ref|NC_008463.1|:103012-104871 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAACCCGCGCCTGCTCGAGTACTACAACCAGGAATTGCAACACATCCGCGAAAGCGCCGCGGAGTTCG
CCGAGGAGTTCCCGAAGATCGCCGGGCGCCTGTCGCTGTCCGGCTTCGAGTGCGCCGACCCCTACGTCGA
GCGCCTGCTGGAAGGCTTCGCCTATCTCACCGCGCGGGTCCAGCTGAAGCTCGACGCGGAGTACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCACTACCTGGCGCCGACTCCGTCGATGACCGTGGTGC
AGCTGCGCCCGGACCCCAACGAAGGCGCCCTGAGCAGCGGCTTCAGCGTCGAGCGCGGGGCCTCCCTGCG
CGGCCAGCTCGGCCCCGATGACCAGACCGCCTGCGAATACCGCACCGCCCACCCGGTGACCCTGTGGCCG
CTGGAAGTGGCCCAGGCCGACTACTTCGGCAATCCCGCCGCGGTGCTCGGCCGCCTCGCCGCCAGCGAGC
CGCGGGCCAAGGCCGGCCTGCGCATCCGCCTGCGCAGCGGCGCCGGTATCCCGTTCGACAGCCTGTCGCT
GGACGCCCTGCCGCTCTACCTGCACGGCGCCGACGAACAACCCTACCGCCTCTACGAACAATTGCTCGGC
AACGCCTGCGCGGTGTTCGTCCGCGCCCCGGACAATGCCTGGGTCGAACGCCTGCCGACGAGCAGCCTGC
GTGCGCGTGGCTTCGACGACGAGGACGCGCTGCTGCCGGTGGTGCCGCGGGCGTTCCAGGGCTACCGCCT
GCTGCAGGAATACTTCGCCCTGCCGGCGCGCTTCCTGTTCGTCGAGTTCTCCGGCCTGAACCGCGCCCTG
CGTCGATGCCACGGCGAGGAGCTGGAACTGGTCGTGCTGTTCGGCAAGCACGACCAGCGCCTGGAGGGCA
CGGTGGACGCGGAGCAACTGGTGCCGTTCTGCACCCCGGCGATCAACCTGTTCCCGCGCCGCTGCGACCG
CATCCACCTGTCCGACCGGGTCAACGAGCATCATGTGATCGTCGACCGCACCCGTCCGCTGGATTTCGAG
GTGCATTCGCTGCAACAGGTGAGCGGCCACGGCAGCGGTCCGGAGCAACCCTTCCAACCGTTCTACGCGG
TGCGCGACCCGGCGCGCTACGGCCGCGAGCAGGCCTACTTCAGCGTGCGCCGCGAACCGCGCGTGCTGTC
CAGCAAGCAGCGGCGCAAGGGCCCGCGCTCGACCTACGTCGGCAGCGAGACCTTCGTCGCCCTGGTCGAC
GCCAACCAGGCGCCCTATCGCCACGACCTGCGCCAGCTCGGCATCGCCGCGCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGCCGATCGGCGCGCACAAGAGCGACTTCACCCTGGAGGACAGCGCCCCGGTCATGCA
GGTGCGCTGCCTCGCCGGACCGAGCCGGCCGCGCGCCAGCCGTGCCCACGATGCCAGCGCCTGGCGGCTG
ATCAGCCAGCTGTCGCTGAACTACCTGTCGTTGGCCGAGCGCGGCCAGGGCGCCGCCGCCCTGCGCGAGC
TGCTGCGGCTCTACGGCGACAGCGGCGATCCGGCGCTGCAACTGCAGATCGAGGGCCTGCGCGAGGTCAG
CAGCAAGCCTTGCACGCGGCGCCTGCCGATGCCCGGGCCGATCGTCTTCGGCCGTGGCCTGGAGATCACC
CTGGACTTCGACGAGAACGCGTTCCGTGGCACCGGGGTGTTCCTCCTCGGCGCCGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGCTGCGCACCGGCGAACGGGGCGAGGTGAT
GAGATGGCAGGCGAAGCCGGGCAGCCGTCCGAACCTCTGA