SecReT6
Protein ID: 116053812
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_01120
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]110675..110959 [-]
Producthypothetical protein
NoteTsi6 (i)
UniProt IDQ02UY7
KEGG IDpau:PA14_01120
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|116053812|ref|YP_788249.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSPVNYVERALALVAERLARHPQCGMLLSVEKQLLYLKAVLLDRSLDRSALHRLSFGGIAGKEFEETDPE
LARALKDAFYVGIRTGRGLKVDLP
 
Nucleotide Sequence: 285 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c110959-110675 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTCCCCCGTGAACTATGTCGAACGCGCCCTGGCGCTGGTCGCCGAGCGGCTGGCCCGGCATCCGCAAT
GCGGGATGCTGCTCTCCGTGGAAAAGCAGTTGCTGTACCTGAAAGCCGTGCTGCTCGACCGCAGCCTGGA
CCGTTCCGCGTTGCACCGGCTGAGCTTCGGCGGCATCGCCGGGAAAGAGTTCGAGGAGACCGACCCGGAA
CTCGCCAGGGCCCTCAAGGACGCATTCTACGTCGGCATACGCACTGGCCGCGGCCTGAAGGTCGACCTAC
CCTGA