SecReT6
Protein ID: 116054405
SecReT6 ID150
T6SS typei3
Gene symbol-
Locus tagPA14_00925
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]92696..94045 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ02V02
KEGG IDpau:PA14_00925
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-70, Aligned region: 66..271
OmpA [PF00691], Evalue: 8.60E-16, Aligned region: 339..437
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 90..139
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 202..268
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 336..369
DUF883 [PF05957], Evalue: 0.0075, Aligned region: 397..434
Protein Sequence: 449 a.a.     [Download]
>gi|116054405|ref|YP_788234.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSGRGDGLNPLEQ
AAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWG
STSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEAL
RERTAAVIRSTRGEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFK
RIHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDE
FQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVATNASAEGRARNRRVEITVFAEGAQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c94045-92696 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCTCCCATCGACGATCCCTTCGGCACCCCGGCCGGCGGCGGCAACGGAAGCCCGCCCGACGACCGCA
CCATGATCATGCCGCGTCCCGGCGGCCGCGCCCCGGAACCGGCCGGCGGCCCCCGCGGCGGCGATCCCTA
CACGCCGCCGCCGATGGCCAGCCTGGCGCCGCTGAGCGGCCGCGGCGACGGCCTCAACCCGCTGGAGCAG
GCCGCCGGCCCACTGCTGGCGATGCTCACCCGCCTGCGCAACACCATCGCCCATCCGGCGCCGGCCAGCC
TGCGCGCGCAACTGCTCGGCTACCTGCGCCAGTTCGAGGAGAAGGCACGCCAGGCCGGCGTGGCGCCGGA
CGAAGTGATGCTGGCGCGCTACGTGCTCTGCACCGCCCTCGACGAAGCGGTGCTCAGCACGCCGTGGGGC
AGCACCAGCGACTGGGGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAGAAGG
TCTTCCAGTTGCTCGAACACTGCCTGCAGAACCCGCACCAGCGCCTGCACCTGCTGGAGCTGCTGTACCT
GTGCACCAGCCTCGGCTTCGAAGGCCGCTACCGGGTCATGCACGACGGCCGCAGCCAACTGGAGGCGCTG
CGCGAGCGCACCGCGGCGGTGATCCGCAGCACCCGCGGCGAGTACGAGCACGAACTGTCGCCGCACTGGC
GCGGCCTCAGCGTGATGCGCGACCGCCTTTCGCAATACCTGCCGCCGTGGGTCGGTATCGCCATCGGCCT
GGCCTTGCTGCTGGCCTTGCTGTTCGGCCTGCGGATGAAGCTGGCCGCCGACGCCGAGCCGGTGTTCAAG
CGCATCCACGCCATCGGCGAGATCCCGGTGCAGGCCATCGACCGCCCAGCGGTGCAGCCGCGGGTGATCG
AACGGCCACGCCTGGCGCGCTTCCTCGCAGACGACATCAAGGCCCAGCGGGTGGCGGTGGAGGACGCCGT
CGACCGCTCGGTGGTGACCATCCGCGGCGACGAGCTGTTCGCCAGCGCCAGCGCCAGCGTGCGCGACGAG
TTCCAGCCGCTGCTGCTGCGCATCGCCGACGCCCTGCGCAAGGTCAAGGGCCAGGTGCTGGTCACCGGCC
ATAGCGACAACCGGCCGATCGCCACGCTGCGCTACCCGTCCAACTGGAAACTGTCCCAGGCCCGCGCCCA
GGAGGTCGCCGACCTGCTCGGCGCGACCACCGGCGACGCCGGCCGCTTCACCGCCGAAGGGCGCAGCGAC
ACCGAGCCGGTGGCGACCAACGCCAGCGCCGAAGGCCGCGCACGCAACCGCCGGGTGGAAATCACCGTAT
TCGCGGAGGGCGCGCAATGA