SecReT6
Protein ID: 116249130
SecReT6 ID147
T6SS typei5
Gene symbolimpK
Locus tagpRL120465
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL12 [GenBank: NC_008378] [Browse all T6SS(s) in this replicon]
Location [Strand]502072..503604 [-]
Productputative outer membrane porin involved in nitrogen fixation
NoteTssL
UniProt IDQ1M3Z9
KEGG IDrle:pRL120465
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-56, Aligned region: 78..282
OmpA [PF00691], Evalue: 4.20E-13, Aligned region: 107..131
OmpA [PF00691], Evalue: 4.20E-13, Aligned region: 372..469
Protein Sequence: 510 a.a.     [Download]
>gi|116249130|ref|YP_764971.1| putative outer membrane porin involved in nitrogen fixation [Rhizobium leguminosarum bv. viciae 3841]
MKNEPASTWQNLPTIVELTEDGTRKKQSARKMAEMLDDVLDFPESEGGKTPAGSLPKGAASVETLVRDFR
FGAEDVPTLVRSAAPLLNLAHGLRYTEEQPDIDELRQVAIEAVGRYERDLASARISPERARAAHYVICAT
VDDVVLSKAWGVRAGWARSGLVSTFHMDVTGGERVFDLLDHFHQSPGANKDLLLLIYLCLSLAFEGRTRV
SPRGGLELGRIRDGLYKTLLGQYGVFERELSPHWKGVSARHQPLRTAAAIWTLLSLLTLILALGYMFFTL
SLNRASDGTFERLARLPPRDMPSVLVKVPEPPRQQPPVVVAETPPPPPPPQVKPPSRLDNLLAFLQPEVE
KKLVTLSDSNGRLLVRISNSGLFATGSAEVSQKFHDLLQRIGGALAAENFRAVVVGYTDNVPIRTVQFPS
NWHLSEARAKAVGEILSSFTGPGAILTEGRADTDPIAANDTPEGREMNRRTEILVLTDPSERLNDAGLTT
PRRADMPDEPTAPAAGGGSR
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|116248676|ref|NC_008378.1|:c503604-502072 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL12, complete sequence
ATGAAGAACGAACCCGCCTCCACCTGGCAGAACCTGCCGACCATTGTCGAACTTACCGAGGACGGCACTC
GGAAAAAGCAATCCGCCCGCAAGATGGCGGAGATGCTGGATGACGTCCTCGACTTTCCCGAAAGCGAGGG
CGGAAAGACGCCGGCGGGATCGCTTCCGAAGGGCGCAGCCTCCGTCGAAACGCTCGTCCGGGATTTTCGC
TTCGGAGCCGAAGACGTGCCGACGCTGGTGCGCTCGGCCGCACCGCTCCTCAACCTCGCCCATGGCCTGC
GCTACACGGAAGAACAGCCTGATATCGACGAACTGCGCCAGGTGGCGATCGAAGCCGTCGGCCGCTACGA
ACGCGATCTGGCGAGCGCCCGCATCAGCCCCGAACGAGCGCGCGCCGCCCATTACGTCATCTGTGCGACG
GTCGACGATGTCGTGCTCAGCAAGGCCTGGGGCGTTCGCGCCGGCTGGGCCCGCTCGGGGCTCGTTTCCA
CCTTCCATATGGACGTGACCGGCGGCGAACGGGTGTTCGACCTGCTCGACCATTTCCACCAGAGCCCCGG
CGCCAACAAGGACCTGCTTCTCCTCATCTATCTCTGCCTGTCACTTGCCTTCGAGGGCCGCACCCGCGTT
TCACCGCGCGGCGGGCTGGAGCTCGGCCGCATCCGCGACGGCCTTTACAAGACGCTGCTTGGCCAGTACG
GCGTCTTCGAACGAGAGCTTTCTCCCCACTGGAAGGGCGTTTCGGCCCGGCATCAGCCGTTGCGCACCGC
GGCCGCGATCTGGACGCTTCTTTCCCTTCTGACGCTGATCCTGGCGCTCGGCTACATGTTCTTCACGCTC
TCGCTCAATCGCGCCTCCGACGGAACGTTCGAGCGGCTCGCCAGGCTGCCGCCGCGCGATATGCCGAGCG
TACTCGTCAAGGTTCCGGAGCCGCCTCGGCAGCAGCCGCCCGTCGTCGTCGCCGAAACGCCGCCGCCGCC
GCCACCGCCGCAAGTGAAACCGCCGAGCCGGCTCGACAATCTGCTCGCCTTCCTCCAGCCGGAGGTCGAG
AAGAAGCTCGTCACACTCTCGGATTCGAATGGCAGGCTGCTGGTGCGGATCAGCAATTCCGGCCTGTTTG
CCACCGGCAGCGCGGAGGTCAGTCAAAAATTCCACGATCTTCTCCAGCGGATCGGCGGTGCGCTGGCCGC
AGAGAACTTCCGCGCCGTGGTGGTGGGTTATACCGACAATGTGCCGATCCGCACCGTGCAGTTCCCCTCC
AACTGGCACCTTTCCGAAGCCCGCGCCAAGGCGGTCGGCGAAATCCTGAGCTCCTTCACCGGGCCGGGTG
CGATCCTGACCGAGGGGCGTGCCGACACCGATCCGATCGCCGCCAACGATACGCCGGAGGGCCGGGAGAT
GAACCGCCGCACCGAGATCCTGGTCCTGACCGATCCGAGCGAGCGGCTGAACGATGCGGGTTTGACGACG
CCGCGTCGGGCCGACATGCCGGATGAACCGACGGCGCCCGCCGCAGGAGGTGGTTCGCGATGA